Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIRBP, Mouse (His)

CIRBP protein, a key player in cellular response to genotoxic stress, stabilizes survival-associated transcripts. It aids stress granule assembly, suppresses cell proliferation in the cold, and regulates translation. CIRBP interacts with EIF4G1, associates with ribosomes, and targets the 3'-UTRs of stress-responsive transcripts like RPA2 and TXN. It contributes to intricate molecular regulatory mechanisms. CIRBP Protein, Mouse (His) is the recombinant mouse-derived CIRBP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CIRBP Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cirbp-protein-mouse-his.html

Purity

95.00

Smiles

MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Molecular Formula

12696 (Gene_ID) P60824 (M1-E172) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Julabo Assembly Cooling Coil for Counter-Cooling with Tap Water
BAT8168 1 Each

Julabo Assembly Cooling Coil for Counter-Cooling with Tap Water

Ask
View Details
NEUROG2 (ATOH4, BHLHA8, NGN2, Neurogenin-2, Class A Basic Helix-loop-helix Protein 8, Protein Atonal Homolog 4, NGN-2, MGC46562) ) (FITC)
130314-FITC 100 µL

NEUROG2 (ATOH4, BHLHA8, NGN2, Neurogenin-2, Class A Basic Helix-loop-helix Protein 8, Protein Atonal Homolog 4, NGN-2, MGC46562) ) (FITC)

Ask
View Details
Rabbit Polyclonal SCRT2 Antibody
NBP2-55969-25ul 25 µL

Rabbit Polyclonal SCRT2 Antibody

Ask
View Details
TRAF6 Antibody, FITC conjugated
A37399-50UG 50 µg

TRAF6 Antibody, FITC conjugated

Ask
View Details
FITC conjugated antibody to CLU Antibody (MOFY-0722-FY195)
MOFY-0722-FY195 Each

FITC conjugated antibody to CLU Antibody (MOFY-0722-FY195)

Ask
View Details