Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIRBP, Mouse (His)

CIRBP protein, a key player in cellular response to genotoxic stress, stabilizes survival-associated transcripts. It aids stress granule assembly, suppresses cell proliferation in the cold, and regulates translation. CIRBP interacts with EIF4G1, associates with ribosomes, and targets the 3'-UTRs of stress-responsive transcripts like RPA2 and TXN. It contributes to intricate molecular regulatory mechanisms. CIRBP Protein, Mouse (His) is the recombinant mouse-derived CIRBP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CIRBP Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cirbp-protein-mouse-his.html

Purity

95.00

Smiles

MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Molecular Formula

12696 (Gene_ID) P60824 (M1-E172) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PDE4A Mouse Monoclonal Antibody [Clone 6B6]
E45M09814V-2 50 µL

PDE4A Mouse Monoclonal Antibody [Clone 6B6]

Ask
View Details
RPL9 (60S Ribosomal Protein L9, OK/SW-cl.103, RPL9P7, RPL9P8, RPL9P9, DKFZp313J1510, FLJ27456, MGC15545, NPCA16 Ribosomal Protein L9) (MaxLight 405) discontinued
138307-ML405 100 µL

RPL9 (60S Ribosomal Protein L9, OK/SW-cl.103, RPL9P7, RPL9P8, RPL9P9, DKFZp313J1510, FLJ27456, MGC15545, NPCA16 Ribosomal Protein L9) (MaxLight 405) discontinued

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Ribonuclease 3 (rnc)
MBS1088061-01 0.02 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Ribonuclease 3 (rnc)

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Ribonuclease 3 (rnc)
MBS1088061-02 0.1 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Ribonuclease 3 (rnc)

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Ribonuclease 3 (rnc)
MBS1088061-03 0.02 mg (Yeast)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Ribonuclease 3 (rnc)

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Ribonuclease 3 (rnc)
MBS1088061-04 0.1 mg (Yeast)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Ribonuclease 3 (rnc)

Ask
View Details