Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIRBP, Mouse (His)

CIRBP protein, a key player in cellular response to genotoxic stress, stabilizes survival-associated transcripts. It aids stress granule assembly, suppresses cell proliferation in the cold, and regulates translation. CIRBP interacts with EIF4G1, associates with ribosomes, and targets the 3'-UTRs of stress-responsive transcripts like RPA2 and TXN. It contributes to intricate molecular regulatory mechanisms. CIRBP Protein, Mouse (His) is the recombinant mouse-derived CIRBP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CIRBP Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cirbp-protein-mouse-his.html

Purity

95.00

Smiles

MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Molecular Formula

12696 (Gene_ID) P60824 (M1-E172) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WBP11 antibody - N-terminal region
MBS3208130-01 0.1 mL

WBP11 antibody - N-terminal region

Ask
View Details
WBP11 antibody - N-terminal region
MBS3208130-02 5x 0.1 mL

WBP11 antibody - N-terminal region

Ask
View Details
IL27RA (Interleukin 27 Receptor alpha, Interleukin-27 Receptor Subunit alpha, IL-27 Receptor Subunit alpha, IL-27R Subunit alpha, IL-27R-alpha, IL27RA, IL-27RA, IL27R, Cytokine Receptor WSX-1, Cytokine Receptor-like 1, CRL1, Type I T-cell Cytokine Receptor, TCCR, UNQ296/PRO336, WSX1, WSX-1, ZcytoR1) (APC)
128457-APC 100 µL

IL27RA (Interleukin 27 Receptor alpha, Interleukin-27 Receptor Subunit alpha, IL-27 Receptor Subunit alpha, IL-27R Subunit alpha, IL-27R-alpha, IL27RA, IL-27RA, IL27R, Cytokine Receptor WSX-1, Cytokine Receptor-like 1, CRL1, Type I T-cell Cytokine Receptor, TCCR, UNQ296/PRO336, WSX1, WSX-1, ZcytoR1) (APC)

Ask
View Details
Rhbdf1 Mouse qPCR Primer Pair (NM_010117)
MP212806 200 Reactions

Rhbdf1 Mouse qPCR Primer Pair (NM_010117)

Ask
View Details
CDK5RAP2 Polyclonal Antibody
MBS2573864-01 0.06 mL

CDK5RAP2 Polyclonal Antibody

Ask
View Details
CDK5RAP2 Polyclonal Antibody
MBS2573864-02 0.12 mL

CDK5RAP2 Polyclonal Antibody

Ask
View Details