Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIRBP, Mouse (His)

CIRBP protein, a key player in cellular response to genotoxic stress, stabilizes survival-associated transcripts. It aids stress granule assembly, suppresses cell proliferation in the cold, and regulates translation. CIRBP interacts with EIF4G1, associates with ribosomes, and targets the 3'-UTRs of stress-responsive transcripts like RPA2 and TXN. It contributes to intricate molecular regulatory mechanisms. CIRBP Protein, Mouse (His) is the recombinant mouse-derived CIRBP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CIRBP Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cirbp-protein-mouse-his.html

Purity

95.00

Smiles

MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Molecular Formula

12696 (Gene_ID) P60824 (M1-E172) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WISP1, Recombinant, Human (CCN4, WNT1-Inducible-Signaling Pathway Protein 1, CCN Family Member 4, Wnt-1-Induced Secreted Protein)
298315 10 µg

WISP1, Recombinant, Human (CCN4, WNT1-Inducible-Signaling Pathway Protein 1, CCN Family Member 4, Wnt-1-Induced Secreted Protein)

Ask
View Details
ACOT9 Antibody, HRP conjugated
A72576-50UG 50 µg

ACOT9 Antibody, HRP conjugated

Ask
View Details
Chicken Anti-Gliadin Antibody (AGA) ELISA Kit
EIA05217Ch 1 Kit

Chicken Anti-Gliadin Antibody (AGA) ELISA Kit

Ask
View Details
Lentiviral human PHYKPL shRNA (UAS) - Lentiviral human PHYKPL shRNA (UAS, iRFP) (100)
GTR15336210 1 Vial

Lentiviral human PHYKPL shRNA (UAS) - Lentiviral human PHYKPL shRNA (UAS, iRFP) (100)

Ask
View Details
Goat Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit
MBS7258811-01 48 Well

Goat Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit

Ask
View Details
Goat Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit
MBS7258811-02 96 Well

Goat Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit

Ask
View Details