Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIRBP, Mouse (His)

CIRBP protein, a key player in cellular response to genotoxic stress, stabilizes survival-associated transcripts. It aids stress granule assembly, suppresses cell proliferation in the cold, and regulates translation. CIRBP interacts with EIF4G1, associates with ribosomes, and targets the 3'-UTRs of stress-responsive transcripts like RPA2 and TXN. It contributes to intricate molecular regulatory mechanisms. CIRBP Protein, Mouse (His) is the recombinant mouse-derived CIRBP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CIRBP Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cirbp-protein-mouse-his.html

Purity

95.00

Smiles

MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE

Molecular Formula

12696 (Gene_ID) P60824 (M1-E172) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rpl39 (NM_026055) Mouse Untagged Clone
MC202087 10 µg

Rpl39 (NM_026055) Mouse Untagged Clone

Ask
View Details
Rat Signal Transducer And Activator Of Transcription 6 ELISA Kit
MBS3809489-01 48 Well

Rat Signal Transducer And Activator Of Transcription 6 ELISA Kit

Ask
View Details
Rat Signal Transducer And Activator Of Transcription 6 ELISA Kit
MBS3809489-02 96 Well

Rat Signal Transducer And Activator Of Transcription 6 ELISA Kit

Ask
View Details
Rat Signal Transducer And Activator Of Transcription 6 ELISA Kit
MBS3809489-03 5x 96 Well

Rat Signal Transducer And Activator Of Transcription 6 ELISA Kit

Ask
View Details
Rat Signal Transducer And Activator Of Transcription 6 ELISA Kit
MBS3809489-04 10x 96 Well

Rat Signal Transducer And Activator Of Transcription 6 ELISA Kit

Ask
View Details
Biotin-Linked Monoclonal Antibody to Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7)
MBS2112889-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7)

Ask
View Details