Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Caveolin-1 (Cav1)

Product Specifications

Product Name Alternative

Cav

Abbreviation

Recombinant Rat Cav1 protein

Gene Name

Cav1

UniProt

P41350

Expression Region

2-178aa

Organism

Rattus norvegicus (Rat)

Target Sequence

SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

May act as a scaffolding protein within caveolar membranes. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins to the caveolae. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Involved in the costimulatory signal essential for T-cell receptor (TCR) -mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.9 kDa

References & Citations

"Co-localization and interaction of b0, +-type amino acid transporter 1 (BAT1) with caveolin-1 in rat kidney." Kwak J.O., Kim H.W., Jung S.M., Song J.H., Hong S.B., Oh K.J., Ko C.B., Cha S.H. J. Nephrol. 18:681-689 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kappa Light Chain (TB28-2), CF568 conjugate, 0.1mg/mL
BNC680708-500 1x 500 µL

Kappa Light Chain (TB28-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sh3gl3 Mouse Gene Knockout Kit (CRISPR)
KN515721 1 Kit

Sh3gl3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IKK gamma (IKBKG) (NM_003639) Human Over-expression Lysate
LC401206 20 µg

IKK gamma (IKBKG) (NM_003639) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti Human RASSF6 Polyclonal
Y055727 100 µL

Anti Human RASSF6 Polyclonal

Sign In for Pricing
View Details
Mouse Calreticulin (CRT) ELISA Kit
RDR-CRT-Mu-01 96 Tests

Mouse Calreticulin (CRT) ELISA Kit

Sign In for Pricing
View Details
Mouse Calreticulin (CRT) ELISA Kit
RDR-CRT-Mu-02 48 Tests

Mouse Calreticulin (CRT) ELISA Kit

Sign In for Pricing
View Details