Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Resistin, Mouse (HEK293, Fc)

Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

Resistin Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/resistin-protein-mouse-hek293-fc.html

Purity

97.00

Smiles

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Molecular Formula

57264 (Gene_ID) Q99P87 (S21-S114) (Accession)

Molecular Weight

Approximately 39 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGS Multiplex PCR Master Mix II, 2X
NM2002 400 Reactions

NGS Multiplex PCR Master Mix II, 2X

Sign In for Pricing
View Details
Anti-CD45RO Antibody [UCHL1], Biotin-100ug
QAB44-B-100ug 100ug

Anti-CD45RO Antibody [UCHL1], Biotin-100ug

Sign In for Pricing
View Details
THRAP5 (Mediator Complex Subunit 16, DRIP92, THRAP5, TRAP95) (MaxLight 405) discontinued
252634-ML405 100 µL

THRAP5 (Mediator Complex Subunit 16, DRIP92, THRAP5, TRAP95) (MaxLight 405) discontinued

Sign In for Pricing
View Details
BSG Polyclonal Antibody
bs-55026R 100 µL

BSG Polyclonal Antibody

Sign In for Pricing
View Details
CCDC23 (SVBP) (NM_199342) Human Over-expression Lysate
LC403705 20 µg

CCDC23 (SVBP) (NM_199342) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Plakophilin 1 (PKP1) ELISA Kit
MBS162601-01 48 Well

Mouse Plakophilin 1 (PKP1) ELISA Kit

Sign In for Pricing
View Details