Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Resistin, Mouse (HEK293, Fc)

Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

Resistin Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/resistin-protein-mouse-hek293-fc.html

Purity

97.00

Smiles

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Molecular Formula

57264 (Gene_ID) Q99P87 (S21-S114) (Accession)

Molecular Weight

Approximately 39 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC8A (NM_019594) Human Recombinant Protein
PH38009M5 20 µg

LRRC8A (NM_019594) Human Recombinant Protein

Sign In for Pricing
View Details
Thap3 (NM_175152) Mouse Tagged Lenti ORF Clone
MR202471L4 10 µg

Thap3 (NM_175152) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Escherichia coli, O157 (E. coli)
E3500-37G-01 100 µg

Escherichia coli, O157 (E. coli)

Sign In for Pricing
View Details
Escherichia coli, O157 (E. coli)
E3500-37G-02 1 mg

Escherichia coli, O157 (E. coli)

Sign In for Pricing
View Details
KCNE3 Recombinant Protein (Mouse)
RP144998 100 µg

KCNE3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (MaxLight 550)
246905-ML550 100 µL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (MaxLight 550)

Sign In for Pricing
View Details