Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Resistin, Mouse (HEK293, Fc)

Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

Resistin Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/resistin-protein-mouse-hek293-fc.html

Purity

97.00

Smiles

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Molecular Formula

57264 (Gene_ID) Q99P87 (S21-S114) (Accession)

Molecular Weight

Approximately 39 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mause anti-MOVlO Monoclonal Antibody, Affinity Purified [15C1B8]
A500-009ACF 100 µg

Mause anti-MOVlO Monoclonal Antibody, Affinity Purified [15C1B8]

Sign In for Pricing
View Details
Usmg5 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7018902 1.0 µg DNA

Usmg5 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rat Anti-tissue transglutaminase IgA, tTG-IgA ELISA kit
YLA1614RA-01 48 Tests

Rat Anti-tissue transglutaminase IgA, tTG-IgA ELISA kit

Sign In for Pricing
View Details
Rat Anti-tissue transglutaminase IgA, tTG-IgA ELISA kit
YLA1614RA-02 96 Tests

Rat Anti-tissue transglutaminase IgA, tTG-IgA ELISA kit

Sign In for Pricing
View Details
Duox1 Mouse qPCR Primer Pair (NM_001099297)
MP221254 200 Reactions

Duox1 Mouse qPCR Primer Pair (NM_001099297)

Sign In for Pricing
View Details
Carnosine Dipeptidase 1/CNDP1 Recombinant Protein Antigen
NBP1-85528PEP 0.1 mL

Carnosine Dipeptidase 1/CNDP1 Recombinant Protein Antigen

Sign In for Pricing
View Details