Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Resistin, Mouse (HEK293, Fc)

Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

Resistin Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/resistin-protein-mouse-hek293-fc.html

Purity

97.00

Smiles

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Molecular Formula

57264 (Gene_ID) Q99P87 (S21-S114) (Accession)

Molecular Weight

Approximately 39 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-500 1x 500 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF568 conjugate, 0.1mg/mL
BNC681846-500 1x 500 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details