Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Resistin, Mouse (HEK293, Fc)

Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

Resistin Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/resistin-protein-mouse-hek293-fc.html

Purity

97.00

Smiles

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Molecular Formula

57264 (Gene_ID) Q99P87 (S21-S114) (Accession)

Molecular Weight

Approximately 39 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNC1LI2, ID (DYNC1LI2, DNCLI2, LIC2, Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC53/55)
MBS6008283-01 0.2 mL

DYNC1LI2, ID (DYNC1LI2, DNCLI2, LIC2, Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC53/55)

Sign In for Pricing
View Details
DYNC1LI2, ID (DYNC1LI2, DNCLI2, LIC2, Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC53/55)
MBS6008283-02 5x 0.2 mL

DYNC1LI2, ID (DYNC1LI2, DNCLI2, LIC2, Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC53/55)

Sign In for Pricing
View Details
CA9 Antibody, FITC conjugated
A76836-50UL 50 μL

CA9 Antibody, FITC conjugated

Sign In for Pricing
View Details
SPAST CRISPRa sgRNA lentivector (set of three targets)(Rat)
45210126 3x 1.0µg DNA

SPAST CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
CBLN1 Protein Vector (Human) (pPB-C-His)
PV067549 500 ng

CBLN1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human C4 Binding Protein Beta (C4BPb) ELISA Kit
MBS2702420-01 24 Strip Well

Human C4 Binding Protein Beta (C4BPb) ELISA Kit

Sign In for Pricing
View Details