Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Resistin, Mouse (HEK293, Fc)

Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

Resistin Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/resistin-protein-mouse-hek293-fc.html

Purity

97.00

Smiles

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Molecular Formula

57264 (Gene_ID) Q99P87 (S21-S114) (Accession)

Molecular Weight

Approximately 39 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS7 (NM_024407) Human Recombinant Protein
TP761711 50 µg

NDUFS7 (NM_024407) Human Recombinant Protein

Sign In for Pricing
View Details
PCR Tube 8 Strip - white (Attached Cap)
KD484903-125 0.1 mL

PCR Tube 8 Strip - white (Attached Cap)

Sign In for Pricing
View Details
CHTF8 (Chromosome Transmission Fidelity Protein 8 Homolog isoform 2, Decreased Expression in renal and Prostate Cancer Protein, CHTF8, DERPC) (MaxLight 650) discontinued
302355-ML650 100 µL

CHTF8 (Chromosome Transmission Fidelity Protein 8 Homolog isoform 2, Decreased Expression in renal and Prostate Cancer Protein, CHTF8, DERPC) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Non-sterile PP Syringe Filters, 0.22 (μm), 4 (mm), 100pcs/pk
11084101 100 PCS

Non-sterile PP Syringe Filters, 0.22 (μm), 4 (mm), 100pcs/pk

Sign In for Pricing
View Details
Microscope Slides Triticum (Wheat) Leaf TS
4041800/6 1 Each

Microscope Slides Triticum (Wheat) Leaf TS

Sign In for Pricing
View Details
Klrb1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6661606 1.0 µg DNA

Klrb1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details