Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Resistin, Mouse (HEK293, Fc)

Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

Resistin Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/resistin-protein-mouse-hek293-fc.html

Purity

97.00

Smiles

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Molecular Formula

57264 (Gene_ID) Q99P87 (S21-S114) (Accession)

Molecular Weight

Approximately 39 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNJ16259685 50mg
A20545-50 50 mg

JNJ16259685 50mg

Sign In for Pricing
View Details
AC133 (CD133) Antibody (C-term) Blocking Peptide
MBS9231444-01 0.5 mg

AC133 (CD133) Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
AC133 (CD133) Antibody (C-term) Blocking Peptide
MBS9231444-02 5x 0.5 mg

AC133 (CD133) Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
LOC100359968 3'UTR Luciferase Stable Cell Line
TU207387 1.0 mL

LOC100359968 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat Monoclonal CXCL13/BLC/BCA-1 Antibody (RM0205-19N1)
NBP2-12223-0.025mg 0.025 mg

Rat Monoclonal CXCL13/BLC/BCA-1 Antibody (RM0205-19N1)

Sign In for Pricing
View Details
ZIC3 Antibody
A38695-100UL 100 µL

ZIC3 Antibody

Sign In for Pricing
View Details