Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASPH, Human (His-SUMO)

ASPH protein phosphorylates SPRTN, facilitating its chromatin recruitment and decreasing replication stress. ASPH activates the G2/M checkpoint by phosphorylating and inhibiting PABIR1/FAM122A, leading to serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity. ASPH Protein, Human (His-SUMO) is the recombinant human-derived ASPH protein, expressed by E. coli, with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ASPH Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asph-protein-human-his-sumo.html

Smiles

FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT

Molecular Formula

444 (Gene_ID) Q12797 (F75-T270) (Accession)

Molecular Weight

Approximately 38.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
Adcyap1 Mouse Gene Knockout Kit (CRISPR)
KN500896 1 Kit

Adcyap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human STMP1 activation kit by CRISPRa
GA118799 1 Kit

Human STMP1 activation kit by CRISPRa

Sign In for Pricing
View Details
RC3H1 (NM_172071) Human Recombinant Protein
TP312335 20 µg

RC3H1 (NM_172071) Human Recombinant Protein

Sign In for Pricing
View Details
Synaptotagmin (Ab-309) Antibody
8B0032-AAT 50 µg

Synaptotagmin (Ab-309) Antibody

Sign In for Pricing
View Details