Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASPH, Human (His-SUMO)

ASPH protein phosphorylates SPRTN, facilitating its chromatin recruitment and decreasing replication stress. ASPH activates the G2/M checkpoint by phosphorylating and inhibiting PABIR1/FAM122A, leading to serine/threonine-protein phosphatase 2A-mediated dephosphorylation and stabilization of WEE1 levels and activity. ASPH Protein, Human (His-SUMO) is the recombinant human-derived ASPH protein, expressed by E. coli, with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ASPH Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/asph-protein-human-his-sumo.html

Smiles

FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT

Molecular Formula

444 (Gene_ID) Q12797 (F75-T270) (Accession)

Molecular Weight

Approximately 38.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS634056 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
gamma-Valerolactone
TRC-V091455-50G 50 g

gamma-Valerolactone

Sign In for Pricing
View Details
Dienogest
TRC-D441870-25MG 25 mg

Dienogest

Sign In for Pricing
View Details
Recombinant Uracil DNA Glycosylase Antibody
RC-16149-01 50 μL

Recombinant Uracil DNA Glycosylase Antibody

Sign In for Pricing
View Details
Recombinant Uracil DNA Glycosylase Antibody
RC-16149-02 100 µL

Recombinant Uracil DNA Glycosylase Antibody

Sign In for Pricing
View Details
Recombinant Uracil DNA Glycosylase Antibody
RC-16149-03 1 mL

Recombinant Uracil DNA Glycosylase Antibody

Sign In for Pricing
View Details