Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aspartate aminotransferase, mitochondrial (GOT2)

Product Specifications

Product Name Alternative

(mAspAT) (Fatty acid-binding protein) (FABP-1) (Glutamate oxaloacetate transaminase 2) (Kynurenine aminotransferase 4) (Kynurenine aminotransferase IV) (Kynurenine--oxoglutarate transaminase 4) (Kynurenine--oxoglutarate transaminase IV) (Plasma membrane-associated fatty acid-binding protein) (FABPpm) (Transaminase A)

Abbreviation

Recombinant Human GOT2 protein

Gene Name

GOT2

UniProt

P00505

Expression Region

30-430aa

Organism

Homo sapiens (Human)

Target Sequence

SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA) . As a member of the malate-aspartate shuttle, it has a key role in the intracellular NAD (H) redox balance. Is important for metabolite exchange between mitochondria and cytosol, and for amino acid metabolism. Facilitates cellular uptake of long-chain free fatty acids.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

52.2 kDa

References & Citations

"Toward a comprehensive characterization of a human cancer cell phosphoproteome." Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S. J. Proteome Res. 12:260-271 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-100 1x 100 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D205), CF568 conjugate, 0.1mg/mL
BNC680205-100 1x 100 µL

Complement C4d (C4D205), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684), CF740 conjugate, 0.1mg/mL
BNC740684-100 1x 100 µL

CD68 (C68/684), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details