Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART4/CD297, Mouse (HEK293, His)

ART4/CD297 Protein , a protein that contains a mono-ADP-ribosylation (ART) motif, is involved in peptidyl-arginine ADP-ribosylation. It is a member of the ADP-ribosyltransferase gene family. ART4 is expressed in several structures, including cardiovascular system, genitourinary system, integumental system, liver; and sensory organ. In addition, ART4 plays an important role in erythrocyte invasion by P. falciparum. ART4/CD297 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ART4/CD297 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ART4/CD297 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/art4-cd297-protein-mouse-hek293-his.html

Purity

97.00

Smiles

GSTEAPLKVDVDLTPDSFDDQYQGCSEQMVEELNQGDYFIKEVDTHKYYSRAWQKAHLTWLNQAKALPESMTPVHAVAIVVFTLNLNVSSDLAKAMARAAGSPGQYSQSFHFKYLHYYLTSAIQLLRKDSSTKNGSLCYKVYHGMKDVSIGANVGSTIRFGQFLSASLLKEETRVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKSGSPKGDLINLRSAGNMSTYNCQLLK

Molecular Formula

109978 (Gene_ID) Q9CRA0 (G24-K263) (Accession)

Molecular Weight

Approximately 38-45 kDa due to the glycosylation.

References & Citations

[1]Olivieri A, et al. Structural organization of erythrocyte membrane microdomains and their relation with malaria susceptibility. Commun Biol. 2021 Dec 8;4 (1) :1375.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
BNC940806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-100 1x 100 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-100 1x 100 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-500 1x 500 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF594 conjugate, 0.1mg/mL
BNC941927-100 1x 100 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details