Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H2B 1.1, Xenopus laevis

Histone H2B 1.1 protein is a key nucleosome component that compacts DNA into chromatin, thereby restricting access to cellular processes. Histone H2B 1.1 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2B 1.1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Histone H2B 1.1 Protein, Xenopus laevis, Xenopus laevis, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/histone-h2b-1-1-protein-xenopus-laevis.html

Purity

95

Smiles

AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Molecular Formula

446588 (Gene_ID) P02281 (A5-K126) (Accession)

Molecular Weight

Approximately 13.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM205 Antibody
A36866-100UG 100 µg

TMEM205 Antibody

Sign In for Pricing
View Details
ZBP1 CRISPR/Cas9 KO Plasmid (m)
sc-425482 20 µg

ZBP1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
C19orf59 ORF Vector (Human) (pORF)
ORF016504 1.0 µg DNA

C19orf59 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PLVX-EnCMV-IGF1R (human) (2Synonymous mutation) -Myc-Puro
BZ44420 1 Vial

PLVX-EnCMV-IGF1R (human) (2Synonymous mutation) -Myc-Puro

Sign In for Pricing
View Details
Trichomonas vaginalis 1 (T. vaginalis, TV) (AP)
MBS6248371-01 0.1 mL

Trichomonas vaginalis 1 (T. vaginalis, TV) (AP)

Sign In for Pricing
View Details
Trichomonas vaginalis 1 (T. vaginalis, TV) (AP)
MBS6248371-02 5x 0.1 mL

Trichomonas vaginalis 1 (T. vaginalis, TV) (AP)

Sign In for Pricing
View Details