Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H2B 1.1, Xenopus laevis

Histone H2B 1.1 protein is a key nucleosome component that compacts DNA into chromatin, thereby restricting access to cellular processes. Histone H2B 1.1 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2B 1.1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Histone H2B 1.1 Protein, Xenopus laevis, Xenopus laevis, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/histone-h2b-1-1-protein-xenopus-laevis.html

Purity

95

Smiles

AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Molecular Formula

446588 (Gene_ID) P02281 (A5-K126) (Accession)

Molecular Weight

Approximately 13.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAF1 (CHAF1A) Human siRNA Oligo Duplex (Locus ID 10036)
SR306753 1 Kit

CAF1 (CHAF1A) Human siRNA Oligo Duplex (Locus ID 10036)

Sign In for Pricing
View Details
Rabbit Polyclonal SCD-1 Antibody
NBP3-30358 100 µg

Rabbit Polyclonal SCD-1 Antibody

Sign In for Pricing
View Details
UBE3C (m) -PR
sc-154860-PR 10 µM - 20 µL

UBE3C (m) -PR

Sign In for Pricing
View Details
PRMT6 Polyclonal Antibody
ANT-13927-100ug 100 µg

PRMT6 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SLC6A17 Antibody
NBP3-17542-25ul 25 µL

Rabbit Polyclonal SLC6A17 Antibody

Sign In for Pricing
View Details
Anti-HIP2  (1D10)
YF-MA13457 100 ug

Anti-HIP2 (1D10)

Sign In for Pricing
View Details