THSD1, Human (HEK293, His)
THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
THSD1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html
Purity
95.0
Smiles
EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI
Molecular Formula
55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)
Molecular Weight
60-90 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6137321-01 0.1 mL
KLK1 (Kallikrein-1, Kidney/Pancreas/Salivary Gland Kallikrein, Tissue Kallikrein) APC
Sign In for Pricing
View Details 
MBS6137321-02 5x 0.1 mL
KLK1 (Kallikrein-1, Kidney/Pancreas/Salivary Gland Kallikrein, Tissue Kallikrein) APC
Sign In for Pricing
View Details 
PCR-0108-CLD 125 / Box - 10 Boxes/Carton
0.1ml qPCR 8-tube strip,with caps
Sign In for Pricing
View Details