Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Human (HEK293, His)

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html

Purity

95.0

Smiles

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI

Molecular Formula

55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Msl3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3730704 1.0 µg DNA

Msl3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Plant G Protein Coupled Receptor 120 (GPR120) ELISA Kit
MBS9376333 Inquire

Plant G Protein Coupled Receptor 120 (GPR120) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal TFF3 Antibody (3H7)
H00007033-M03 0.1 mg

Mouse Monoclonal TFF3 Antibody (3H7)

Sign In for Pricing
View Details
GSTP1 Antibody, mAb, Rabbit
A04896-50 50 µL

GSTP1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Mouse Monoclonal PMS1 Antibody (CL14436)
NBP3-26854-25ul 25 µL

Mouse Monoclonal PMS1 Antibody (CL14436)

Sign In for Pricing
View Details
MRPL20 Polyclonal Antibody
BS65803-01 50 µL

MRPL20 Polyclonal Antibody

Sign In for Pricing
View Details