Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Human (HEK293, His)

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html

Purity

95.0

Smiles

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI

Molecular Formula

55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DC2L1 (DYNC2LI1) (NM_016008) Human Tagged ORF Clone
RG202656 10 µg

DC2L1 (DYNC2LI1) (NM_016008) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human SLC26A4 sgRNA gene knockout kit - Lentiviral human SLC26A4 sgRNA gene knockout kit (plasmid)
GTR15368192 1 Vial

Lentiviral human SLC26A4 sgRNA gene knockout kit - Lentiviral human SLC26A4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
MYP1 3'UTR GFP Stable Cell Line
TU065117 1.0 mL

MYP1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PL6 (m) -PR
sc-152286-PR 10 µM - 20 µL

PL6 (m) -PR

Sign In for Pricing
View Details
Rat Notch3 ELISA Kit
EF019083 96 Tests

Rat Notch3 ELISA Kit

Sign In for Pricing
View Details
IGF-IR(Phospho Tyr1346) Polyclonal Antibody
JOT-AP08820-01 50ul

IGF-IR(Phospho Tyr1346) Polyclonal Antibody

Sign In for Pricing
View Details