Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Human (HEK293, His)

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html

Purity

95.0

Smiles

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI

Molecular Formula

55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal THBS1 Antibody (Center), Clone: 518CT18.12.8
APR10934G 0.1ml

Monoclonal THBS1 Antibody (Center), Clone: 518CT18.12.8

Sign In for Pricing
View Details
V1RE8 shRNA Plasmid (m)
sc-155038-SH 20 µg

V1RE8 shRNA Plasmid (m)

Sign In for Pricing
View Details
IGF I Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-4588R-BF405 100 µL

IGF I Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
VincuLin (VCL) (NM_003373) Human Tagged ORF Clone
RC204576 10 µg

VincuLin (VCL) (NM_003373) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cendakimab Biosimilar (Monoclonal, IgG1)
A138341 100 µL

Cendakimab Biosimilar (Monoclonal, IgG1)

Sign In for Pricing
View Details
FGF-23, human
RC215-34 5ug

FGF-23, human

Sign In for Pricing
View Details