Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Human (HEK293, His)

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html

Purity

95.0

Smiles

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI

Molecular Formula

55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit CCKAR (Cholecystokinin A Receptor) ELISA Kit
ERb22480 96 Tests

Rabbit CCKAR (Cholecystokinin A Receptor) ELISA Kit

Sign In for Pricing
View Details
Neisseria gonorrhoeae antibody
10R-7778 500 ug

Neisseria gonorrhoeae antibody

Sign In for Pricing
View Details
SLC36A2 antibody
70R-6321 50 ug

SLC36A2 antibody

Sign In for Pricing
View Details
SPRR2A Mouse Monoclonal Antibody [Clone ID: OTI1B1]
CF808490 100 µg

SPRR2A Mouse Monoclonal Antibody [Clone ID: OTI1B1]

Sign In for Pricing
View Details
Biotin - Gastrin Releasing Peptide, human
M41176-01 100 mg

Biotin - Gastrin Releasing Peptide, human

Sign In for Pricing
View Details
Biotin - Gastrin Releasing Peptide, human
M41176-02 25 mg

Biotin - Gastrin Releasing Peptide, human

Sign In for Pricing
View Details