Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Human (HEK293, His)

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html

Purity

95.0

Smiles

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI

Molecular Formula

55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEAB Rabbit mAb
MBS4761134-01 0.1 mL

HEAB Rabbit mAb

Sign In for Pricing
View Details
HEAB Rabbit mAb
MBS4761134-02 5x 0.1 mL

HEAB Rabbit mAb

Sign In for Pricing
View Details
CDC20 (NM_001255) Human Tagged ORF Clone
RG200911 10 µg

CDC20 (NM_001255) Human Tagged ORF Clone

Sign In for Pricing
View Details
Irs3 ORF Vector (Mouse) (pORF)
ORF048086 1.0 µg DNA

Irs3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
P42 MAPK (ERK2) Antibody Conjugated to HRP
B2015891 50 µg

P42 MAPK (ERK2) Antibody Conjugated to HRP

Sign In for Pricing
View Details
ZFP42 Protein Lysate (Mouse) with C-HA Tag
50965034 100 µg

ZFP42 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details