Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Human (HEK293, His)

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html

Purity

95.0

Smiles

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI

Molecular Formula

55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nkx2-2 ORF Vector (Mouse) (pORF)
ORF051417 1.0 µg DNA

Nkx2-2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
GOSR2 Antibody, Biotin conjugated
A23577-50UG 50 µg

GOSR2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PEnCMV-USP44 (human) (273-712aa) -3xFLAG-SV40-Neo
BZ40678 1 Vial

PEnCMV-USP44 (human) (273-712aa) -3xFLAG-SV40-Neo

Sign In for Pricing
View Details
Rabbit Monoclonal HPV16 Antibody (HPV16/2058R)
NBP3-07310-100ug 100 µg

Rabbit Monoclonal HPV16 Antibody (HPV16/2058R)

Sign In for Pricing
View Details
Mouse Mff Pre-designed siRNA Set A
SI108407A 1 Each

Mouse Mff Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Ovalbumin sIgE (OVA sIgE) ELISA Kit
EIA06159m 1 Kit

Mouse Ovalbumin sIgE (OVA sIgE) ELISA Kit

Sign In for Pricing
View Details