Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Human (HEK293, His)

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html

Purity

95.0

Smiles

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI

Molecular Formula

55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDKRB2 (NM_000623) Human Tagged ORF Clone Lentiviral Particle
RC210378L3V 200 µL

BDKRB2 (NM_000623) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olfr484 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4268605 3x 1.0 µg

Olfr484 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Nlrp3 Antibody
MBS7044169-01 0.05 mg

Nlrp3 Antibody

Sign In for Pricing
View Details
Nlrp3 Antibody
MBS7044169-02 0.1 mg

Nlrp3 Antibody

Sign In for Pricing
View Details
Nlrp3 Antibody
MBS7044169-03 5x 0.1 mg

Nlrp3 Antibody

Sign In for Pricing
View Details
Imatinib impurities3
MF-0119596-01 10 mg

Imatinib impurities3

Sign In for Pricing
View Details