Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Human (HEK293, His)

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html

Purity

95.0

Smiles

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI

Molecular Formula

55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Escherichia coli (E. coli) (FITC) discontinued
E3500-18-FITC 200 µL

Escherichia coli (E. coli) (FITC) discontinued

Sign In for Pricing
View Details
Vom1r59 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
50047116 3x 1.0 µg

Vom1r59 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Inhbb 3'UTR Luciferase Stable Cell Line
TU206298 1.0 mL

Inhbb 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZNF573 (NM_001172691) Human Tagged ORF Clone
RC230409 10 µg

ZNF573 (NM_001172691) Human Tagged ORF Clone

Sign In for Pricing
View Details
ADAM17 Protein Vector (Rat) (pPM-C-His)
PV252177 500 ng

ADAM17 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Goat Glutamic acid decarboxylase (GAD) ELISA Kit
NSL0722Gt 96 Tests

Goat Glutamic acid decarboxylase (GAD) ELISA Kit

Sign In for Pricing
View Details