Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THSD1, Human (HEK293, His)

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

THSD1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html

Purity

95.0

Smiles

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI

Molecular Formula

55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SPRR4 sgRNA gene knockout kit - Lentiviral human SPRR4 sgRNA gene knockout kit (100)
GTR15394909 1 Vial

Lentiviral human SPRR4 sgRNA gene knockout kit - Lentiviral human SPRR4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
IDH1, Human (R132H, His)
HY-P704085-01 10 µg

IDH1, Human (R132H, His)

Sign In for Pricing
View Details
IDH1, Human (R132H, His)
HY-P704085-02 50 µg

IDH1, Human (R132H, His)

Sign In for Pricing
View Details
IDH1, Human (R132H, His)
HY-P704085-03 100 µg

IDH1, Human (R132H, His)

Sign In for Pricing
View Details
Melatonin Related Receptor (GPR50) (NM_004224) Human Tagged ORF Clone Lentiviral Particle
RC217839L4V 200 µL

Melatonin Related Receptor (GPR50) (NM_004224) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
galectin-16 Double Nickase Plasmid (h)
sc-418389-NIC 20 µg

galectin-16 Double Nickase Plasmid (h)

Sign In for Pricing
View Details