THSD1, Human (HEK293, His)
THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
THSD1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/thsd1-protein-human-hek-293-his.html
Purity
95.0
Smiles
EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI
Molecular Formula
55901 (Gene_ID) Q9NS62-2 (E25-I361) (Accession)
Molecular Weight
60-90 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC201297L3V 200 µL
Asparagine synthetase (ASNS) (NM_001673) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
6446-30 0.5 mg
Donkey F (ab') 2 Anti-Rabbit IgG (H+L), Mouse/Rat/Human SP ads-AF488
Sign In for Pricing
View Details MBS7200924-01 48 Well
Mouse ATP-binding cassette sub-family C member 9 (ABCC9) ELISA Kit
Sign In for Pricing
View Details MBS7200924-02 96 Well
Mouse ATP-binding cassette sub-family C member 9 (ABCC9) ELISA Kit
Sign In for Pricing
View Details