Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18, Rat

IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN) -γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.

Product Specifications

Product Name Alternative

IL-18 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18-protein-rat.html

Purity

95.00

Smiles

HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

Molecular Formula

29197 (Gene_ID) P97636-1 (H37-S194) (Accession)

Molecular Weight

Approximately 18.4 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Ye XJ, et al. The effects of interleukin-18 on rat articular chondrocytes: a study of mRNA expression and protein synthesis of proinflammatory substances. Clin Exp Immunol. 2007 Sep;149 (3) :553-60.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipase (LPS) Activity Assay Kit
E-BC-K786-M-01 48 T (24 samples)

Lipase (LPS) Activity Assay Kit

Sign In for Pricing
View Details
Lipase (LPS) Activity Assay Kit
E-BC-K786-M-02 96 T (48 samples)

Lipase (LPS) Activity Assay Kit

Sign In for Pricing
View Details
TLCD1 (NM_001160407) Human Over-expression Lysate
LY431159 100 µg

TLCD1 (NM_001160407) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Adipose tissue
CS500887 5x 5 µm

Frozen Tissue Sections, Adipose tissue

Sign In for Pricing
View Details
(R)-2-Bromosuccinic Acid
TRC-B688805-2.5G 2.5 g

(R)-2-Bromosuccinic Acid

Sign In for Pricing
View Details
Recombinant Mouse IL21 protein (His tag)
PDEM100266-01 20 µg

Recombinant Mouse IL21 protein (His tag)

Sign In for Pricing
View Details