IL-18, Rat
IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN) -γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.
Product Specifications
Product Name Alternative
IL-18 Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-18-protein-rat.html
Purity
95.00
Smiles
HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
Molecular Formula
29197 (Gene_ID) P97636-1 (H37-S194) (Accession)
Molecular Weight
Approximately 18.4 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Ye XJ, et al. The effects of interleukin-18 on rat articular chondrocytes: a study of mRNA expression and protein synthesis of proinflammatory substances. Clin Exp Immunol. 2007 Sep;149 (3) :553-60.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682171-100 1x 100 µL
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
981 24 Tests
Green Fluorescent FAM In vivo Poly (active) Caspase (VAD) Assay
Sign In for Pricing
View Details 
