Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18, Rat

IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN) -γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.

Product Specifications

Product Name Alternative

IL-18 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18-protein-rat.html

Purity

95.00

Smiles

HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

Molecular Formula

29197 (Gene_ID) P97636-1 (H37-S194) (Accession)

Molecular Weight

Approximately 18.4 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Ye XJ, et al. The effects of interleukin-18 on rat articular chondrocytes: a study of mRNA expression and protein synthesis of proinflammatory substances. Clin Exp Immunol. 2007 Sep;149 (3) :553-60.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPOP (NM_003563) Human Over-expression Lysate
LC401186 20 µg

SPOP (NM_003563) Human Over-expression Lysate

Sign In for Pricing
View Details
S Rabbit Polyclonal Antibody
TA381941 100 µL

S Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aquaporin 4 Polyclonal Antibody
E-AB-67499-01 60 µL

Aquaporin 4 Polyclonal Antibody

Sign In for Pricing
View Details
Aquaporin 4 Polyclonal Antibody
E-AB-67499-02 120 µL

Aquaporin 4 Polyclonal Antibody

Sign In for Pricing
View Details
Aquaporin 4 Polyclonal Antibody
E-AB-67499-03 200 µL

Aquaporin 4 Polyclonal Antibody

Sign In for Pricing
View Details
NA/NE (Noradrenaline/Norepinephrine) ELISA Kit
E-EL-0047-01 24 Tests

NA/NE (Noradrenaline/Norepinephrine) ELISA Kit

Sign In for Pricing
View Details