Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Cell death activator CIDE-B (CIDEB)

Product Specifications

Product Name Alternative

Cell death-inducing DFFA-like effector B

Abbreviation

Recombinant Bovine CIDEB protein

Gene Name

CIDEB

UniProt

Q3T191

Expression Region

1-219aa

Organism

Bos taurus (Bovine)

Target Sequence

MEYLSNLDPSSLLRSVSNMSADLGRKVWTSAPPRQRPFRVCDNKRTTRKGLTAATRQELLDKALEALVLSGALTLVLEEDGTTVESEEFFQLLEDDTCLMVLELGQSWSPRRSGVLSYGLGQEKPKHSKDIARITFDVYKQSPRDLFGSLNIKATFYGLYSLSCDIQGLGPKKILRELLRWASSLLQGLGHMLLGISSTLRRAVEGTERWQRQGRLKPY

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Activates apoptosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

68.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), 1mg/mL
BNUM0531-50 1x 50 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), 1mg/mL

Sign In for Pricing
View Details
Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit
RD-Tie1-Mu-01 96 Tests

Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit
RD-Tie1-Mu-02 48 Tests

Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit

Sign In for Pricing
View Details
Human RAD18 activation kit by CRISPRa
GA111236 1 Kit

Human RAD18 activation kit by CRISPRa

Sign In for Pricing
View Details
Tal1 (TAL1/3146), CF640R conjugate, 0.1mg/mL
BNC403146-500 1x 500 µL

Tal1 (TAL1/3146), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), Purified, with BSA, 0.2 mg/mL
BNUB1331-250 1x 250 µL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), Purified, with BSA, 0.2 mg/mL

Sign In for Pricing
View Details