Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein L1 (L1R), partial

Product Specifications

Product Name Alternative

Protein L1 (Virion membrane protein M25)

Abbreviation

Recombinant Vaccinia virus L1R protein, partial

Gene Name

L1R

UniProt

P20540

Expression Region

2-183aa

Organism

Vaccinia virus (strain Copenhagen) (VACV)

Target Sequence

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC) . Needed for fusion and penetration of the virus core into host cell (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.9 kDa

References & Citations

"Identification and analysis of three myristylated vaccinia virus late proteins." Martin K.H., Grosenbach D.W., Franke C.A., Hruby D.E. J. Virol. 71:5218-5226 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SVIL Polyclonal Antibody
RA35132-01 50 µL

SVIL Polyclonal Antibody

Sign In for Pricing
View Details
SVIL Polyclonal Antibody
RA35132-02 100 µL

SVIL Polyclonal Antibody

Sign In for Pricing
View Details
Human Apo AII
MBS3908025-01 1 mg

Human Apo AII

Sign In for Pricing
View Details
Human Apo AII
MBS3908025-02 5x 1 mg

Human Apo AII

Sign In for Pricing
View Details
RP105 (CD180), Antibody
GWB-5772FA 0.1 mg

RP105 (CD180), Antibody

Sign In for Pricing
View Details
KRTAP21P1 AAV siRNA Pooled Vector
60964161 1.0 µg

KRTAP21P1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details