Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Auxin-binding protein 1 (ABP1)

Product Specifications

Product Name Alternative

ERABP1

Abbreviation

Recombinant Zea mays ABP1 protein

Gene Name

ABP1

UniProt

P13689

Expression Region

39-201aa

Organism

Zea mays (Maize)

Target Sequence

SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

This is probably a receptor for the plant hormone auxin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for the plant hormone auxin.

Molecular Weight

22.4 kDa

References & Citations

Molecular analysis of three maize 22KDA auxin-binding protein genes -- transient promoter expression and regulatory regions.Schwob E., Choi S.-Y., Simmons C., Migliaccio F., Ilag L., Hesse T., Palme K., Soell D.Plant J. 4:423-432 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pygopus Homolog 1 (Pygopus-1, PYGO1)
MBS609075-01 0.1 mg

Pygopus Homolog 1 (Pygopus-1, PYGO1)

Sign In for Pricing
View Details
Pygopus Homolog 1 (Pygopus-1, PYGO1)
MBS609075-02 5x 0.1 mg

Pygopus Homolog 1 (Pygopus-1, PYGO1)

Sign In for Pricing
View Details
Sheep Cluster of Differentiation 74 ELISA Kit
MBS031639-01 48 Well

Sheep Cluster of Differentiation 74 ELISA Kit

Sign In for Pricing
View Details
Sheep Cluster of Differentiation 74 ELISA Kit
MBS031639-02 96 Well

Sheep Cluster of Differentiation 74 ELISA Kit

Sign In for Pricing
View Details
Sheep Cluster of Differentiation 74 ELISA Kit
MBS031639-03 5x 96 Well

Sheep Cluster of Differentiation 74 ELISA Kit

Sign In for Pricing
View Details
Sheep Cluster of Differentiation 74 ELISA Kit
MBS031639-04 10x 96 Well

Sheep Cluster of Differentiation 74 ELISA Kit

Sign In for Pricing
View Details