Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA6/CD85b/ILT-8, Human (HEK293, N-His)

LILRA6/CD85b/ILT-8 protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and regulation. Its interaction with class I MHC molecules has been shown to be involved in monitoring and potentially modulating immune responses. LILRA6/CD85b/ILT-8 Protein, Human (HEK293, N-His) is the recombinant human-derived LILRA6/CD85b/ILT8 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRA6/CD85b/ILT-8 Protein, Human (HEK293, N-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilra6-cd85b-ilt8-protein-human-hek293-n-his.html

Purity

98.00

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN

Molecular Formula

79168 (Gene_ID) Q6PI73-1 (G24-N447) (Accession)

Molecular Weight

55-85 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP12 siRNA (Rat)
orb1830689-01 15 nmol

CASP12 siRNA (Rat)

Sign In for Pricing
View Details
CASP12 siRNA (Rat)
orb1830689-02 30 nmol

CASP12 siRNA (Rat)

Sign In for Pricing
View Details
NUDT4 Antibody
MBS8593553-01 0.1 mg

NUDT4 Antibody

Sign In for Pricing
View Details
NUDT4 Antibody
MBS8593553-02 0.1 mL (AF405L)

NUDT4 Antibody

Sign In for Pricing
View Details
NUDT4 Antibody
MBS8593553-03 0.1 mL (AF405S)

NUDT4 Antibody

Sign In for Pricing
View Details
NUDT4 Antibody
MBS8593553-04 0.1 mL (AF610)

NUDT4 Antibody

Sign In for Pricing
View Details