Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A1, Human (HEK293, hFc)

The S100A1 gene encodes a protein that regulates cellular processes, with potential roles in Ca2+ release, microtubule assembly, and protein phosphorylation. Decreased expression is linked to cardiomyopathies, highlighting its importance in heart-related conditions. It is abundantly expressed in the heart, salivary gland, and other tissues. S100A1 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A1 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

S100A1 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a1-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Molecular Formula

6271 (Gene_ID) NP_006262.1 (G2-S94) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-500 1x 500 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-100 1x 100 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details