Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A1, Human (HEK293, hFc)

The S100A1 gene encodes a protein that regulates cellular processes, with potential roles in Ca2+ release, microtubule assembly, and protein phosphorylation. Decreased expression is linked to cardiomyopathies, highlighting its importance in heart-related conditions. It is abundantly expressed in the heart, salivary gland, and other tissues. S100A1 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A1 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

S100A1 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a1-protein-human-hek293-hfc.html

Purity

95.0

Smiles

GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Molecular Formula

6271 (Gene_ID) NP_006262.1 (G2-S94) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Rattus norvegicus (Rat) Hgf Polyclonal Antibody
MBS7142942 Inquire

Rabbit anti-Rattus norvegicus (Rat) Hgf Polyclonal Antibody

Sign In for Pricing
View Details
PIM1 (pim-1 Oncogene, PIM) (HRP)
250109-HRP 100 µL

PIM1 (pim-1 Oncogene, PIM) (HRP)

Sign In for Pricing
View Details
IL24 Antibody
orb1553899-01 50 μL

IL24 Antibody

Sign In for Pricing
View Details
IL24 Antibody
orb1553899-02 100 µL

IL24 Antibody

Sign In for Pricing
View Details
IL24 Antibody
orb1553899-03 200 µL

IL24 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MAK10 Antibody [DyLight 488]
NBP1-77057G 0.1 mL

Rabbit Polyclonal MAK10 Antibody [DyLight 488]

Sign In for Pricing
View Details