Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIG/CXCL9, Human

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis[1][2]. MIG/CXCL9 Protein, Human is produced in E.coil, and consists of 103 amino acids (T23-T125) .

Product Specifications

Product Name Alternative

MIG/CXCL9 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mig-cxcl9-protein-human.html

Purity

97.67

Smiles

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Molecular Formula

4283 (Gene_ID) Q07325 (T23-T125) (Accession)

Molecular Weight

Approximately 11.7 kDa

References & Citations

[1]Bolomsky A, et al. Monokine induced by interferon gamma (MIG/CXCL9) is an independent prognostic factor in newly diagnosed myeloma. Leuk Lymphoma. 2016 Nov;57 (11) :2516-25.|[2]Qiang Ding, et al. CXCL9: evidence and contradictions for its role in tumor progression. Cancer Med. 2016 Nov;5 (11) :3246-3259.|[3]Weigang Xiu, et al. CXCL9 secreted by tumor-associated dendritic cells up-regulates PD-L1 expression in bladder cancer cells by activating the CXCR3 signaling. BMC Immunol. 2021 Jan 6;22 (1) :3.|[4]Chao-Feng Lin, et al. Potential Effects of CXCL9 and CCL20 on Cardiac Fibrosis in Patients with Myocardial Infarction and Isoproterenol-Treated Rats. J Clin Med. 2019 May 11;8 (5) :659.|[5]Hui-Feng Gao, et al. CXCL9 chemokine promotes the progression of human pancreatic adenocarcinoma through STAT3-dependent cytotoxic T lymphocyte suppression. Aging (Albany NY) . 2020 Jan 8;12 (1) :502-517.|[6]Fukuda Y, et al. Endogenous CXCL9 affects prognosis by regulating tumor-infiltrating natural killer cells in intrahepatic cholangiocarcinoma. Cancer Sci. 2020 Feb;111 (2) :323-333.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NARFL Antibody (Center) [APR17533G]
APR17533G-01 50 µL

NARFL Antibody (Center) [APR17533G]

Ask
View Details
NARFL Antibody (Center) [APR17533G]
APR17533G-02 100 µL

NARFL Antibody (Center) [APR17533G]

Ask
View Details
NARFL Antibody (Center) [APR17533G]
APR17533G-03 200 µL

NARFL Antibody (Center) [APR17533G]

Ask
View Details
NARFL Antibody (Center) [APR17533G]
APR17533G-04 400 µL

NARFL Antibody (Center) [APR17533G]

Ask
View Details
Recombinant Human anti-SARS-CoV-02/COVID-019 Monoclonal Nucleocapsid Antibody
MAV116 1 mg

Recombinant Human anti-SARS-CoV-02/COVID-019 Monoclonal Nucleocapsid Antibody

Ask
View Details
FBXL15 Knockout NCI-H1975 Polyclonal Cells
ARG17113 1 Million

FBXL15 Knockout NCI-H1975 Polyclonal Cells

Ask
View Details