Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig NKG2-D type II integral membrane protein (KLRK1), partial

Product Specifications

Product Name Alternative

Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NKG2-D-activating NK receptor; CD antigen CD314

Abbreviation

Recombinant Pig KLRK1 protein, partial

Gene Name

KLRK1

UniProt

Q9GLF5

Expression Region

78-214aa

Organism

Sus scrofa (Pig)

Target Sequence

NLLFNQEAPSPLKESYCGPCPKNWICYRNSCYQFSNESKTWLQSQASCRSQNSSLLKIYSREDQDFFKLVKSYHWMGLVQIPTNRSWQWEDGSILSPNQITMVEMQNGSCAVYGSSFKGYTENCLTLNTYICMKRTV

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8 (+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ADGRG5 shRNA (UAS) - Lentiviral human ADGRG5 shRNA (UAS, RFP) (100)
GTR15091248 1 Vial

Lentiviral human ADGRG5 shRNA (UAS) - Lentiviral human ADGRG5 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CCDC97 (NM_052848) Human Tagged ORF Clone Lentiviral Particle
RC204219L4V 200 µL

CCDC97 (NM_052848) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Phosphate Buffer 0.5M, pH 7.2
41620125-4 4 L

Phosphate Buffer 0.5M, pH 7.2

Sign In for Pricing
View Details
Slc39a9 Rat shRNA Plasmid (Locus ID 314275)
TL703352 1 Kit

Slc39a9 Rat shRNA Plasmid (Locus ID 314275)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Phospholipase C Gamma 2, Phosphatidylinositol Specific (PLCg2)
MBS2073172-01 0.1 mL

HRP-Linked Polyclonal Antibody to Phospholipase C Gamma 2, Phosphatidylinositol Specific (PLCg2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Phospholipase C Gamma 2, Phosphatidylinositol Specific (PLCg2)
MBS2073172-02 0.2 mL

HRP-Linked Polyclonal Antibody to Phospholipase C Gamma 2, Phosphatidylinositol Specific (PLCg2)

Sign In for Pricing
View Details