Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNASET2, Human (HEK293, His)

The RNASET2 protein is a ribonuclease that makes a crucial contribution to the innate immune response by degrading microbial RNA sensed by TLR8. It preferentially cleaves single-stranded RNA, generating products that promote RNA-dependent TLR8 activation. RNASET2 Protein, Human (HEK293, His) is the recombinant human-derived RNASET2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RNASET2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rnaset2-protein-human-hek-293-his.html

Purity

98.0

Smiles

DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

Molecular Formula

8635 (Gene_ID) O00584 (D25-H256) (Accession)

Molecular Weight

38-45 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Epn3 Pre-designed siRNA Set B
SI204517B 1 Each

Rat Epn3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CLPS (Colipase) (APC)
125093-APC 100 µL

CLPS (Colipase) (APC)

Sign In for Pricing
View Details
Mouse Atp5a1 (NM_007505) AAV Particle
MR208769A1V 250 µL

Mouse Atp5a1 (NM_007505) AAV Particle

Sign In for Pricing
View Details
Cefoperazone Sodium Salt
TRC-C242900-5G 5 g

Cefoperazone Sodium Salt

Sign In for Pricing
View Details
Hsa-miR-4726-5p miRNA Inhibitor
orb1871929-01 10 nmol

Hsa-miR-4726-5p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-4726-5p miRNA Inhibitor
orb1871929-02 20 nmol

Hsa-miR-4726-5p miRNA Inhibitor

Sign In for Pricing
View Details