Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OR2A2 sgRNA gene knockout kit - Lentiviral human OR2A2 sgRNA gene knockout kit (25)
GTR15373119 1 Vial

Lentiviral human OR2A2 sgRNA gene knockout kit - Lentiviral human OR2A2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
BUD23 Rabbit Polyclonal Antibody
TA358246 100 µL

BUD23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Leap2 Pre-designed siRNA Set B
SI107491B 1 Each

Mouse Leap2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SCA21 CRISPR Knock Out 293T Cell Line (Human)
43067141 1x 10^6 Cells / 1.0 mL

SCA21 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS808829 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
KCNK1 sgRNA CRISPR Lentivector (Human) (Target 2)
K1122003 1.0 µg DNA

KCNK1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details