Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MACC1 Polyclonal Antibody
MBS9407697-01 0.05 mL

MACC1 Polyclonal Antibody

Sign In for Pricing
View Details
MACC1 Polyclonal Antibody
MBS9407697-02 0.1 mL

MACC1 Polyclonal Antibody

Sign In for Pricing
View Details
MACC1 Polyclonal Antibody
MBS9407697-03 5x 0.1 mL

MACC1 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal RXR gamma/NR2B3 Antibody (PCRP-RXRG-5H4) [DyLight 488]
NBP3-14170G 0.1 mL

Mouse Monoclonal RXR gamma/NR2B3 Antibody (PCRP-RXRG-5H4) [DyLight 488]

Sign In for Pricing
View Details
5-Bromo-2- (tetrahydro-2H-pyran-2-ylmethoxy) aniline
sc-318267 500 mg

5-Bromo-2- (tetrahydro-2H-pyran-2-ylmethoxy) aniline

Sign In for Pricing
View Details
RS18, ID (40S Ribosomal Protein S18, Ke-3, Ke3, D6S218E) (MaxLight 405) discontinued
R2031-39S-ML405 100 µL

RS18, ID (40S Ribosomal Protein S18, Ke-3, Ke3, D6S218E) (MaxLight 405) discontinued

Sign In for Pricing
View Details