Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD11B1 antibody
FNab04021 100 µg

HSD11B1 antibody

Sign In for Pricing
View Details
PTPRG Protein Vector (Rat) (pPM-C-HA)
38175026 500 ng

PTPRG Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Combi 562
OD779R-1PK 1 unit

Combi 562

Sign In for Pricing
View Details
Olr703 (NM_001000359) Rat Tagged ORF Clone Lentiviral Particle
RR215584L4V 200 µL

Olr703 (NM_001000359) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ubiquitin-Like 1-Activating Enzyme E1B (UBA2) Antibody
abx324789-01 50 µg

Ubiquitin-Like 1-Activating Enzyme E1B (UBA2) Antibody

Sign In for Pricing
View Details
Ubiquitin-Like 1-Activating Enzyme E1B (UBA2) Antibody
abx324789-02 100 µg

Ubiquitin-Like 1-Activating Enzyme E1B (UBA2) Antibody

Sign In for Pricing
View Details