Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 1 alpha (IL-1a) (AP) discontinued
I7663-01D1-AP 100 µL

Interleukin 1 alpha (IL-1a) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Rhesus Macaque PDGFRB Protein, His-tagged
MK0596R 10 µg

Recombinant Rhesus Macaque PDGFRB Protein, His-tagged

Sign In for Pricing
View Details
SEMG1 3'UTR Luciferase Stable Cell Line
TU022882 1.0 mL

SEMG1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Csn1s2b (NM_173106) Rat Tagged Lenti ORF Clone
RR207043L4 10 µg

Csn1s2b (NM_173106) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CASD1, NT (CAS1 Domain-containing Protein 1, C7orf12, Nbla04196) (AP)
MBS6467317-01 0.2 mL

CASD1, NT (CAS1 Domain-containing Protein 1, C7orf12, Nbla04196) (AP)

Sign In for Pricing
View Details
CASD1, NT (CAS1 Domain-containing Protein 1, C7orf12, Nbla04196) (AP)
MBS6467317-02 5x 0.2 mL

CASD1, NT (CAS1 Domain-containing Protein 1, C7orf12, Nbla04196) (AP)

Sign In for Pricing
View Details