Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFBRAP1 Adenovirus (Human)
46598051 1.0 mL

TGFBRAP1 Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Rat MAP1LC3B Protein, His (Fc)-Avi-tagged
MAP1LC3B-3214R 50 µg

Recombinant Rat MAP1LC3B Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mouse Monoclonal Mitofusin 1 Antibody (11E9-1H12) [Janelia Fluor 646]
NBP1-71775JF646 0.1 mL

Mouse Monoclonal Mitofusin 1 Antibody (11E9-1H12) [Janelia Fluor 646]

Sign In for Pricing
View Details
Rabbit anti GST-Tag mAb
E45R11657N-100 100 µL

Rabbit anti GST-Tag mAb

Sign In for Pricing
View Details
TFCP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2361807 1.0 µg DNA

TFCP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
HHV-5/HCMV glycoprotein H/gH Recombinant Protein (N-His)
VK665012-01 50 µg

HHV-5/HCMV glycoprotein H/gH Recombinant Protein (N-His)

Sign In for Pricing
View Details