Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RPS3 Antibody [DyLight 488]
NBP2-98930G 0.1 mL

Rabbit Polyclonal RPS3 Antibody [DyLight 488]

Sign In for Pricing
View Details
BRCC36 (BRCC3) Rabbit Polyclonal Antibody
TA374065 100 µL

BRCC36 (BRCC3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Anti-BCMA x Anti-CD3 Bispecific Antibody (Common light chain) (BsIgG)
KN-0422-LN16 0.1 mg

Recombinant Anti-BCMA x Anti-CD3 Bispecific Antibody (Common light chain) (BsIgG)

Sign In for Pricing
View Details
SLC29A3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
44086154 3x 1.0 µg DNA

SLC29A3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica hemC Protein (aa 1-313) (strain 8081)
VAng-Wyb1546-50gEcoli 50 µg (E. coli)

Recombinant Yersinia Enterocolitica hemC Protein (aa 1-313) (strain 8081)

Sign In for Pricing
View Details
SYNJ2BP Rabbit pAb
E45R22033N-100 100 µL

SYNJ2BP Rabbit pAb

Sign In for Pricing
View Details