Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cdk9 ELISA Kit (Colorimetric)
NBP2-75180 1 Kit

Human Cdk9 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Rabbit Polyclonal Rabbit anti-Human IgM Fc5u Secondary Antibody [Janelia Fluor 646] (Pre-adsorbed)
NBP1-72778JF646 0.5 mg

Rabbit Polyclonal Rabbit anti-Human IgM Fc5u Secondary Antibody [Janelia Fluor 646] (Pre-adsorbed)

Sign In for Pricing
View Details
SMCR5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44439111 3x 1.0 µg

SMCR5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
TMSB10 Protein Vector (Mouse) (pPM-C-HA)
PV240136 500 ng

TMSB10 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit anti-human N-alpha-acetyltransferase 10 polyclonal Antibody(NAA10)
MBS1498475-01 0.05 mL

Rabbit anti-human N-alpha-acetyltransferase 10 polyclonal Antibody(NAA10)

Sign In for Pricing
View Details
Rabbit anti-human N-alpha-acetyltransferase 10 polyclonal Antibody(NAA10)
MBS1498475-02 0.1 mL

Rabbit anti-human N-alpha-acetyltransferase 10 polyclonal Antibody(NAA10)

Sign In for Pricing
View Details