Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal S5a/Angiocidin Antibody (CPTC-PSMD4-3) [DyLight 350]
NBP3-08271UV 100 µL

Mouse Monoclonal S5a/Angiocidin Antibody (CPTC-PSMD4-3) [DyLight 350]

Sign In for Pricing
View Details
Human FZD4 full length protein-synthetic nanodisc
E33F100139 10 µg

Human FZD4 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Cdca2 (NM_001110162) Mouse Tagged ORF Clone
MG217306 10 µg

Cdca2 (NM_001110162) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Hbp1 3'UTR GFP Stable Cell Line
TU159383 1.0 mL

Hbp1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human PVR Protein
CRP2187-01 10 µg

Recombinant Human PVR Protein

Sign In for Pricing
View Details
Recombinant Human PVR Protein
CRP2187-02 50 µg

Recombinant Human PVR Protein

Sign In for Pricing
View Details