Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pik3c2a Pre-designed siRNA Set B
SI110561B 1 Each

Mouse Pik3c2a Pre-designed siRNA Set B

Sign In for Pricing
View Details
L-Alanine-2-d1-N-t-BOC
B600401 2.5 mg

L-Alanine-2-d1-N-t-BOC

Sign In for Pricing
View Details
2- (3,4-Dimethoxyphenyl) azepane, HCl
413506-01 100 mg

2- (3,4-Dimethoxyphenyl) azepane, HCl

Sign In for Pricing
View Details
2- (3,4-Dimethoxyphenyl) azepane, HCl
413506-02 250 mg

2- (3,4-Dimethoxyphenyl) azepane, HCl

Sign In for Pricing
View Details
Rabbit Monoclonal CD200R1 Antibody (118) [CoraFluor 1]
NBP2-89845CL1 0.1 mL

Rabbit Monoclonal CD200R1 Antibody (118) [CoraFluor 1]

Sign In for Pricing
View Details
MBNL1 (NM_207295) Human Recombinant Protein
TP319704 20 µg

MBNL1 (NM_207295) Human Recombinant Protein

Sign In for Pricing
View Details