Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

p14 ARF Antibody
ABF0229 100 µg

p14 ARF Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Hepatocyte Specific Antigen Antibody (SPM582) [Janelia Fluor 646]
NBP2-34814JF646 0.1 mL

Mouse Monoclonal Hepatocyte Specific Antigen Antibody (SPM582) [Janelia Fluor 646]

Sign In for Pricing
View Details
RPL35AP24 Adenovirus (Human)
41503051 1.0 mL

RPL35AP24 Adenovirus (Human)

Sign In for Pricing
View Details
Peptitergent PD1
MBS633728-01 1 mg

Peptitergent PD1

Sign In for Pricing
View Details
Peptitergent PD1
MBS633728-02 5x 1 mg

Peptitergent PD1

Sign In for Pricing
View Details
Cefaclor 2000mg
A10186-2000 2000 mg

Cefaclor 2000mg

Sign In for Pricing
View Details