Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zbtb39 siRNA Oligos set (Rat)
50706176 3x 5 nmol

Zbtb39 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Dinactin discontinued. See D3765
447269-01 1 mg

Dinactin discontinued. See D3765

Sign In for Pricing
View Details
Dinactin discontinued. See D3765
447269-02 2.5 mg

Dinactin discontinued. See D3765

Sign In for Pricing
View Details
Mouse PD-L1 enzyme-linked immunoassay kit
EM0036 96 Tests

Mouse PD-L1 enzyme-linked immunoassay kit

Sign In for Pricing
View Details
Lentiviral mouse Kif22 shRNA (UAS) - Lentiviral mouse Kif22 shRNA (UAS, GFP) (100)
GTR15181305 1 Vial

Lentiviral mouse Kif22 shRNA (UAS) - Lentiviral mouse Kif22 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal USP16 Antibody [Alexa Fluor 532]
NB100-81638AF532 0.1 mL

Rabbit Polyclonal USP16 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details