Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

769-P Cell Line
RWT-956 1x 10^6

769-P Cell Line

Sign In for Pricing
View Details
Rabbit Anti-phospho-Cofilin (Tyr89) antibody
SL5259R-01 50 µL

Rabbit Anti-phospho-Cofilin (Tyr89) antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-Cofilin (Tyr89) antibody
SL5259R-02 100 µL

Rabbit Anti-phospho-Cofilin (Tyr89) antibody

Sign In for Pricing
View Details
Influenza Hemagglutinin (H3N2)(A/Aichi/2/1968), HEK293
MBS430605-01 0.05 mg

Influenza Hemagglutinin (H3N2)(A/Aichi/2/1968), HEK293

Sign In for Pricing
View Details
Influenza Hemagglutinin (H3N2)(A/Aichi/2/1968), HEK293
MBS430605-02 5x 0.05 mg

Influenza Hemagglutinin (H3N2)(A/Aichi/2/1968), HEK293

Sign In for Pricing
View Details
Recombinant Thermoplasma volcanium Tryptophan synthase beta chain (trpB)
MBS1282751-01 0.02 mg (E-Coli)

Recombinant Thermoplasma volcanium Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details