Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C030018G13Rik Mouse siRNA Oligo Duplex (Locus ID 241076)
SR408640 1 Kit

C030018G13Rik Mouse siRNA Oligo Duplex (Locus ID 241076)

Sign In for Pricing
View Details
CK8 (Keratin 8) (5Q5) Mouse Monoclonal antibody
E28PE1422 100 µL

CK8 (Keratin 8) (5Q5) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Recombinant E-Cadherin Antibody / Rabbit Monoclonal
V3565-100UG 100 µg

Recombinant E-Cadherin Antibody / Rabbit Monoclonal

Sign In for Pricing
View Details
RPL3P7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV774686 1.0 µg DNA

RPL3P7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ME2 (NM_001168335) Human Tagged Lenti ORF Clone
RC230146L3 10 µg

ME2 (NM_001168335) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana CBL-interacting serine/threonine-protein kinase 1 (CIPK1)
MBS1279173-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana CBL-interacting serine/threonine-protein kinase 1 (CIPK1)

Sign In for Pricing
View Details