Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC17A8 Recombinant Protein (Human)
RP043378 100 µg

SLC17A8 Recombinant Protein (Human)

Sign In for Pricing
View Details
SEC23 (SEC23A) Human Gene Knockout Kit (CRISPR)
KN405270 1 Kit

SEC23 (SEC23A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
POLR2G antibody
70R-13234 100 ul

POLR2G antibody

Sign In for Pricing
View Details
Mouse Ppip5k2 Pre-designed siRNA Set A
SI110985A 1 Each

Mouse Ppip5k2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GATA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11H3]
TA809113AM 100 µL

GATA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11H3]

Sign In for Pricing
View Details
SLC20A2 Blocking Peptide
33R-2221 100 ug

SLC20A2 Blocking Peptide

Sign In for Pricing
View Details