Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT72 (NM_001146226) Human Tagged ORF Clone
RC228389 10 µg

KRT72 (NM_001146226) Human Tagged ORF Clone

Sign In for Pricing
View Details
KLHL10 (h) -PR
sc-94031-PR 10 µM - 20 µL

KLHL10 (h) -PR

Sign In for Pricing
View Details
CALM3 Antibody
MBS9606954-01 0.1 mL

CALM3 Antibody

Sign In for Pricing
View Details
CALM3 Antibody
MBS9606954-02 0.2 mL

CALM3 Antibody

Sign In for Pricing
View Details
CALM3 Antibody
MBS9606954-03 5x 0.2 mL

CALM3 Antibody

Sign In for Pricing
View Details
IQSEC3 (NM_015232) Human Tagged Lenti ORF Clone
RC220753L4 10 µg

IQSEC3 (NM_015232) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details