Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CXCR2/IL-8RB Antibody (866614R) [DyLight 405]
FAB8110RE 0.1 mL

Mouse Monoclonal CXCR2/IL-8RB Antibody (866614R) [DyLight 405]

Sign In for Pricing
View Details
Irf8 3'UTR GFP Stable Cell Line
TU256377 1.0 mL

Irf8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CAPSO Sodium Salt
40330012-2 100 g

CAPSO Sodium Salt

Sign In for Pricing
View Details
GPR180, ID (GPR180, ITR, Integral membrane protein GPR180, Intimal thickness-related receptor) (FITC)
MBS6303857-01 0.2 mL

GPR180, ID (GPR180, ITR, Integral membrane protein GPR180, Intimal thickness-related receptor) (FITC)

Sign In for Pricing
View Details
GPR180, ID (GPR180, ITR, Integral membrane protein GPR180, Intimal thickness-related receptor) (FITC)
MBS6303857-02 5x 0.2 mL

GPR180, ID (GPR180, ITR, Integral membrane protein GPR180, Intimal thickness-related receptor) (FITC)

Sign In for Pricing
View Details
Larynx and pharynx cancer tissue array with self-matching normal adjacent tissues, formalin fixed
RNS241 10 Cases / 24 Cores

Larynx and pharynx cancer tissue array with self-matching normal adjacent tissues, formalin fixed

Sign In for Pricing
View Details