Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTP4A1 AAV Vector (Human) (CMV)
38127101 1 µg

PTP4A1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand) protein, AF
PROTP49771-7-5ug 5 µg

Human recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand) protein, AF

Sign In for Pricing
View Details
CTX-0124143
C8510-5 5 mg

CTX-0124143

Sign In for Pricing
View Details
Beta glucuronidase Polyclonal Antibody, Cy5 Conjugated
bs-7980R-Cy5 100 µL

Beta glucuronidase Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
PRKCA, NT (Protein Kinase C alpha Type, AAG6, PKC-A, PRKACA, PKCA, PKC-alpha) (FITC) discontinued
P9103-16A8-FITC 200 µL

PRKCA, NT (Protein Kinase C alpha Type, AAG6, PKC-A, PRKACA, PKCA, PKC-alpha) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Tbkbp1 (NM_198100) AAV Particle
MR209269A1V 250 µL

Mouse Tbkbp1 (NM_198100) AAV Particle

Sign In for Pricing
View Details