Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apool Rat siRNA Oligo Duplex (Locus ID 317191)
SR510364 1 Kit

Apool Rat siRNA Oligo Duplex (Locus ID 317191)

Sign In for Pricing
View Details
Rat Monoclonal OX40/TNFRSF4 Antibody (OX-86) [HRP]
NB100-64847H 0.125 mL

Rat Monoclonal OX40/TNFRSF4 Antibody (OX-86) [HRP]

Sign In for Pricing
View Details
Mouse Monoclonal PAC2 Antibody (OTI1E8) [Alexa Fluor 700]
NBP2-73215AF700 0.1 mL

Mouse Monoclonal PAC2 Antibody (OTI1E8) [Alexa Fluor 700]

Sign In for Pricing
View Details
STAMBP Peptide
MBS3236301-01 0.1 mg

STAMBP Peptide

Sign In for Pricing
View Details
STAMBP Peptide
MBS3236301-02 5x 0.1 mg

STAMBP Peptide

Sign In for Pricing
View Details
Nori® Mouse IFNg ELISA Kit
GR106413 96 Well

Nori® Mouse IFNg ELISA Kit

Sign In for Pricing
View Details