Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RB1 Knockout Cell Line-A549
RK-0247 1x 10^6

RB1 Knockout Cell Line-A549

Sign In for Pricing
View Details
Recombinant Coxiella burnetii 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (metE), partial
MBS1060159 Inquire

Recombinant Coxiella burnetii 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (metE), partial

Sign In for Pricing
View Details
HMX2 (H6 Family Homeobox 2, H6L, Nkx5-2) (MaxLight 750)
MBS6238707-01 0.1 mL

HMX2 (H6 Family Homeobox 2, H6L, Nkx5-2) (MaxLight 750)

Sign In for Pricing
View Details
HMX2 (H6 Family Homeobox 2, H6L, Nkx5-2) (MaxLight 750)
MBS6238707-02 5x 0.1 mL

HMX2 (H6 Family Homeobox 2, H6L, Nkx5-2) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Human Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B) Protein
MBS286504-01 0.1 mg

Recombinant Human Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B) Protein

Sign In for Pricing
View Details
Recombinant Human Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B) Protein
MBS286504-02 0.5 mg

Recombinant Human Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B) Protein

Sign In for Pricing
View Details