Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin Heavy Chain
522929-01 100 µL

Ferritin Heavy Chain

Sign In for Pricing
View Details
Ferritin Heavy Chain
522929-02 200 µL

Ferritin Heavy Chain

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707587 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Bcl2 Binding component 3 (BBC3) (NM_001127240) Human Tagged ORF Clone
RC225345 10 µg

Bcl2 Binding component 3 (BBC3) (NM_001127240) Human Tagged ORF Clone

Sign In for Pricing
View Details
OR7E23P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV738160 1.0 µg DNA

OR7E23P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse IL-21  ELISA Kit
LF-EK50913 1×96T

Mouse IL-21 ELISA Kit

Sign In for Pricing
View Details