Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Duox2 shRNA (UAS) - Lentiviral mouseDuox2 shRNA (UAS, GFP) (25)
GTR15170984 1 Vial

Lentiviral mouse Duox2 shRNA (UAS) - Lentiviral mouseDuox2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
NAA16 Protein Vector (Mouse) (pPB-N-His)
PV203883 500 ng

NAA16 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Plk1 Rat shRNA Lentiviral Particle (Locus ID 25515)
TL709910V 500 µL Each

Plk1 Rat shRNA Lentiviral Particle (Locus ID 25515)

Sign In for Pricing
View Details
Lentiviral human PTPRT shRNA (UAS) - Lentiviral human PTPRT shRNA (UAS, GFP) plasmid
GTR15331273 1 Vial

Lentiviral human PTPRT shRNA (UAS) - Lentiviral human PTPRT shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SAPS3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV815364 1.0 µg DNA

SAPS3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Lentiviral human GALNT5 shRNA (UAS) - Lentiviral human GALNT5 shRNA (UAS) (25)
GTR15080381 1 Vial

Lentiviral human GALNT5 shRNA (UAS) - Lentiviral human GALNT5 shRNA (UAS) (25)

Sign In for Pricing
View Details