Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM160B2 Protein Vector (Human) (pPM-C-His)
PV015220 500 ng

FAM160B2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ZNF313, CT (RNF114, ZNF228, ZNF313, RING finger protein 114, Zinc finger protein 228, Zinc finger protein 313) (MaxLight 750) discontinued
044184-ML750 100 µL

ZNF313, CT (RNF114, ZNF228, ZNF313, RING finger protein 114, Zinc finger protein 228, Zinc finger protein 313) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GRHPR Knockout HGC-27 Polyclonal Cells
ARG29869 1 Million

GRHPR Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
Afg3l2 Mouse shRNA Lentiviral Particle (Locus ID 69597)
TL510911V 500 µL Each

Afg3l2 Mouse shRNA Lentiviral Particle (Locus ID 69597)

Sign In for Pricing
View Details
METTL6 (Methyltransferase-Like Protein 6, Methyltransferase Like 6)
485756 100 µL

METTL6 (Methyltransferase-Like Protein 6, Methyltransferase Like 6)

Sign In for Pricing
View Details
Complete Medium for Human Gastric Mucosal Epithelial Cells
abx703951-01 100 mL

Complete Medium for Human Gastric Mucosal Epithelial Cells

Sign In for Pricing
View Details