Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMC4 Human Gene Knockout Kit (CRISPR)
KN412366 1 Kit

SMC4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Gdf15 (NM_019216) Rat Tagged ORF Clone
RR210087 10 µg

Gdf15 (NM_019216) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Cavy Neutrophil Antibody (Anti-NEU) ELISA Kit
MBS9362791 Inquire

Cavy Neutrophil Antibody (Anti-NEU) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal ACBD7 Antibody (005) [DyLight 755]
NBP2-90286IR 0.1 mL

Rabbit Monoclonal ACBD7 Antibody (005) [DyLight 755]

Sign In for Pricing
View Details
Stam (NM_001109121) Rat Untagged Clone
RN213888 10 µg

Stam (NM_001109121) Rat Untagged Clone

Sign In for Pricing
View Details
TXNL4A Protein Vector (Mouse) (pPM-C-HA)
48882024 500 ng

TXNL4A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details