Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC127 Antibody
KC-43642-01 50 μL

CCDC127 Antibody

Sign In for Pricing
View Details
CCDC127 Antibody
KC-43642-02 100 µL

CCDC127 Antibody

Sign In for Pricing
View Details
CCDC127 Antibody
KC-43642-03 1 mL

CCDC127 Antibody

Sign In for Pricing
View Details
NXF3 sgRNA CRISPR Lentivector (Human) (Target 2)
K1471003 1.0 µg DNA

NXF3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RIPK4 (Receptor-interacting Serine/Threonine-protein Kinase 4, Ankyrin Repeat Domain-containing Protein 3, PKC-delta-interacting Protein Kinase, ANKRD3, DIK, MGC129992, MGC129993) (APC)
132602-APC 100 µL

RIPK4 (Receptor-interacting Serine/Threonine-protein Kinase 4, Ankyrin Repeat Domain-containing Protein 3, PKC-delta-interacting Protein Kinase, ANKRD3, DIK, MGC129992, MGC129993) (APC)

Sign In for Pricing
View Details
HTA9 HTA11 Rabbit pAb
A20568 200 µL

HTA9 HTA11 Rabbit pAb

Sign In for Pricing
View Details