Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Chad shRNA (UAS) - Lentiviral mouse Chad shRNA (UAS, RFP) (25)
GTR15186959 1 Vial

Lentiviral mouse Chad shRNA (UAS) - Lentiviral mouse Chad shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human OR2AP1 (Olfactory receptor family 2 subfamily AP member 1) Full Length
MPC2693K Each

Magic™ Membrane Protein Human OR2AP1 (Olfactory receptor family 2 subfamily AP member 1) Full Length

Sign In for Pricing
View Details
HNF 4 alpha (HNF4A) Mouse Monoclonal Antibody [Clone ID: OTI2H2]
CF806582 100 µg

HNF 4 alpha (HNF4A) Mouse Monoclonal Antibody [Clone ID: OTI2H2]

Sign In for Pricing
View Details
Rat Monoclonal TSG Antibody (RM0140-7D19) [Alexa Fluor 488]
NBP1-22516AF488 0.1 mL

Rat Monoclonal TSG Antibody (RM0140-7D19) [Alexa Fluor 488]

Sign In for Pricing
View Details
C4BPA Knockout Cell Lysate
ABC-KC0243 100 µg

C4BPA Knockout Cell Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal Mineralocorticoid R/NR3C2 Antibody [Alexa Fluor 488]
NBP2-99010AF488 0.1 mL

Rabbit Polyclonal Mineralocorticoid R/NR3C2 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details