Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1, Human (P.pastoris, His)

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

RCN1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn1-protein-human-p-pastoris-his.html

Purity

95.0

Smiles

PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Molecular Formula

5954 (Gene_ID) Q15293-1 (P31-L331) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNAB2 Protein Vector (Human) (pPB-N-His)
PV053630 500 ng

KCNAB2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Ret (NM_009050) Mouse Tagged ORF Clone Lentiviral Particle
MR226724L4V 200 µL

Ret (NM_009050) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olfr1134 (NM_147030) Mouse Tagged ORF Clone Lentiviral Particle
MR215545L3V 200 µL

Olfr1134 (NM_147030) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Gse1 Mouse shRNA Lentiviral Particle (Locus ID 382034)
TL511361V 500 µL Each

Gse1 Mouse shRNA Lentiviral Particle (Locus ID 382034)

Sign In for Pricing
View Details
SCZD3 CRISPR Knock Out 293T Cell Line (Human)
43222141 1x 10^6 Cells / 1.0 mL

SCZD3 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human TDG Recombinant Protein
PPT-15603 100 µg

Human TDG Recombinant Protein

Sign In for Pricing
View Details