Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Troponin C/TNNC1, Human (N-His)

Troponin C, represented by the TNNC1 gene, centrally regulates striated muscle contraction. In the troponin complex consisting of Tn-I, Tn-T, and Tn-C, Tn-I inhibits the actomyosin ATPase, while Tn-T binds to tropomyosin. Troponin C/TNNC1 Protein, Human (N-His) is the recombinant human-derived Troponin C/TNNC1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Troponin C/TNNC1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/troponin-c-tnnc1-protein-human-n-his.html

Purity

92.00

Smiles

MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Molecular Formula

7134 (Gene_ID) P63316 (M1-E161) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wnt6 ORF Vector (Mouse) (pORF)
ORF061898 1.0 µg DNA

Wnt6 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Fmoc-Cit-OPfp
B-4155.0005 5.0g

Fmoc-Cit-OPfp

Sign In for Pricing
View Details
Hep C E2 (BDI167)
sc-57769 100 µg/mL

Hep C E2 (BDI167)

Sign In for Pricing
View Details
Spectrin Beta Chain, Non-Erythrocytic 4 (SPTBN4) Antibody (ATTO594)
abx441085 100 µg

Spectrin Beta Chain, Non-Erythrocytic 4 (SPTBN4) Antibody (ATTO594)

Sign In for Pricing
View Details
Recombinant Probable protein E5A
MBS1160651-01 0.02 mg (E-Coli)

Recombinant Probable protein E5A

Sign In for Pricing
View Details
Recombinant Probable protein E5A
MBS1160651-02 0.1 mg (E-Coli)

Recombinant Probable protein E5A

Sign In for Pricing
View Details