Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Pig

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Pig consists of 153 amino acids (A115-P267) and is expressed in E. coli.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Pig, Pig, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-porcine.html

Purity

95.00

Smiles

MANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP

Molecular Formula

397122 (Gene_ID) P26889 (A115-P267) (Accession)

Molecular Weight

Approximately 17.88 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF24 (NM_001193502) Human Recombinant Protein
TP331008L 1 mg

TCF24 (NM_001193502) Human Recombinant Protein

Sign In for Pricing
View Details
Noelin (OLFM1) (NM_014279) Human Over-expression Lysate
LC402301 20 µg

Noelin (OLFM1) (NM_014279) Human Over-expression Lysate

Sign In for Pricing
View Details
DDX59 (NM_001031725) Human Over-expression Lysate
LC422174 20 µg

DDX59 (NM_001031725) Human Over-expression Lysate

Sign In for Pricing
View Details
RGS1 (198-209) Goat Polyclonal Antibody
AP22566PU-N 50 µg

RGS1 (198-209) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 5 Mouse Monoclonal Antibody [Clone ID: AT12C4]
AM50628PU-S 50 µL

Cytokeratin 5 Mouse Monoclonal Antibody [Clone ID: AT12C4]

Sign In for Pricing
View Details
Daxdilimab Biosimilar - Research Grade
ICH5096-20mg 20 mg

Daxdilimab Biosimilar - Research Grade

Sign In for Pricing
View Details