Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Pig

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Pig consists of 153 amino acids (A115-P267) and is expressed in E. coli.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Pig, Pig, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-porcine.html

Purity

95.00

Smiles

MANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP

Molecular Formula

397122 (Gene_ID) P26889 (A115-P267) (Accession)

Molecular Weight

Approximately 17.88 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iron Microplate Assay Kit
RDSM106 100 Assays

Iron Microplate Assay Kit

Sign In for Pricing
View Details
C1ORF95 (STUM) (NM_001003665) Human Over-expression Lysate
LC424093 20 µg

C1ORF95 (STUM) (NM_001003665) Human Over-expression Lysate

Sign In for Pricing
View Details
MEIS1 Mouse Monoclonal Antibody [Clone ID: OTI3H2]
CF809623 100 µg

MEIS1 Mouse Monoclonal Antibody [Clone ID: OTI3H2]

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3226), CF568 conjugate, 0.1mg/mL
BNC683226-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3226), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMAA (NM_172250) Human Recombinant Protein
TP323205M 100 µg

MMAA (NM_172250) Human Recombinant Protein

Sign In for Pricing
View Details
CD33 (C33/69), CF568 conjugate, 0.1mg/mL
BNC680069-100 1x 100 µL

CD33 (C33/69), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details