Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-PRRC2C Antibody Picoband

Product Specifications

Gene Name

[PRRC2C]

NCBI Gene ID

23215

Reactivity

Human

Storage Conditions

At -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months.Avoid repeated freezing and thawing.

Specificity

Expressed in lung, kidney, liver, pancreas, placenta, but not in heart and skeletal muscle.

Other Gene Names

[PRRC2C; PRRC2C; XTP2; BAT2D1; BAT2L2; BAT2-iso; BAT2D1; BAT2L2; KIAA1096; XTP2]

Short Name

[PRRC2C]

Other Product Names

[protein PRRC2C; Protein PRRC2C; protein PRRC2C; protein BAT2-like 2; BAT2 domain containing 1; HBxAg transactivated protein 2; BAT2 domain-containing protein 1; HBV XAg-transactivated protein 2; HBV X-transactivated gene 2 protein; HLA-B associated transcript 2-like 2; HLA-B-associated; proline-rich coiled-coil 2C; BAT2 domain-containing protein 1; HBV X-transactivated gene 2 protein; HBV XAg-transactivated protein 2; HLA-B-associated transcript 2-like 2; Proline-rich and coiled-coil-containing protein 2C]

NCBI GI Number

115298682

NCBI Accession Number

NP_055987.2

NCBI GB Accession Number

NM_015172.3

Uniprot Accession Number

Q9Y520

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galntl5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6359306 1.0 µg DNA

Galntl5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
Lentiviral mouse Prr18 shRNA (UAS) - Lentiviral mouse Prr18 shRNA (UAS, iRFP) (100)
GTR15270939 1 Vial

Lentiviral mouse Prr18 shRNA (UAS) - Lentiviral mouse Prr18 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CULlin 1 (CUL1) Human Gene Knockout Kit (CRISPR)
KN224650LP 1 Kit

CULlin 1 (CUL1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IGSF6 Protein Vector (Mouse) (pPM-C-His)
PV191053 500 ng

IGSF6 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details