Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-alpha 2b/IFNA2, Human (His)

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection[1]. IFN-alpha 2 increases the frequencies of cytotoxic CD8+ T cells and induces CD4+ T cell depletion[3]. IFN-alpha 2b/IFNA2 Protein, Human contains 165 a.a., is produced in E. coli with N-6*His tagged.

Product Specifications

Product Name Alternative

IFN-alpha 2b/IFNA2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-alpha-2a-ifna2-protein-human-his.html

Purity

95.0

Smiles

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Molecular Formula

3440 (Gene_ID) P01563 (C24-E188) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D19 HDR Plasmid (m)
sc-426467-HDR 20 µg

TBC1D19 HDR Plasmid (m)

Sign In for Pricing
View Details
Anti-USP5 Antibody Picoband®, Cy3 Conjugate
A04550-1-Cy3 100 µg/Vial

Anti-USP5 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Rabbit Anti Human SLC12A5 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 200UL
IRBAMLSLC12A5AAP62200UL 200 µL

Rabbit Anti Human SLC12A5 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 200UL

Sign In for Pricing
View Details
eIF5 Rabbit Polyclonal Antibody
MBS9512152-01 0.05 mL

eIF5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
eIF5 Rabbit Polyclonal Antibody
MBS9512152-02 0.1 mL

eIF5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
eIF5 Rabbit Polyclonal Antibody
MBS9512152-03 5x 0.1 mL

eIF5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details