Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM21, Mouse (His-SUMO)

TRIM21 is an E3 ubiquitin protein ligase that forms complexes with E2 enzymes including UBE2D1 and UBE2E2.It cooperates with UBE2D2 to ubiquitinate USP4, IKBKB and itself, and binds to SCF E3 ligase to mediate ubiquitination of CDKN1B.TRIM21 Protein, Mouse (His-SUMO) is the recombinant mouse-derived TRIM21 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

TRIM21 Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trim21-protein-mouse-his-sumo.html

Purity

92.00

Smiles

MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM

Molecular Formula

20821 (Gene_ID) Q62191 (M1-M470) (Accession)

Molecular Weight

Approximately 70.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal uPAR Antibody (014) [DyLight 350]
NBP2-90454UV 0.1 mL

Rabbit Monoclonal uPAR Antibody (014) [DyLight 350]

Sign In for Pricing
View Details
NBPF15 sgRNA CRISPR Lentivector (Human) (Target 2)
K1395803 1.0 µg DNA

NBPF15 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Sowahb ORF Vector (Mouse) (pORF)
ORF058184 1.0 µg DNA

Sowahb ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
APC/iFluor® 700 Anti-non-human primates/ human CD157 Antibody *SY11B5*
115701E1-AAT 100 Tests

APC/iFluor® 700 Anti-non-human primates/ human CD157 Antibody *SY11B5*

Sign In for Pricing
View Details
C6orf182 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV812935 1.0 µg DNA

C6orf182 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
SERPINA6 ELISA Kit (Human) : 96 Wells (OKEH00287)
OKEH00287 96 Well

SERPINA6 ELISA Kit (Human) : 96 Wells (OKEH00287)

Sign In for Pricing
View Details