Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD84/SLAMF5, Mouse (HEK293, His)

CD84/SLAMF5 is an autoligand receptor of the SLAM family that regulates immune cell activation and differentiation through homotypic or heterotypic interactions. Its activity is affected by SH2D1A/SAP and SH2D1B/EAT-2. CD84/SLAMF5 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

CD84/SLAMF5 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd84-slamf5-protein-mouse-221a-a-hek293-c-his.html

Purity

99.00

Smiles

KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV

Molecular Formula

12523 (Gene_ID) Q18PI6-1 (K22-V221) (Accession)

Molecular Weight

32-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 Antibody
orb1326697 100 µg

CD27 Antibody

Sign In for Pricing
View Details
SLITRK4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-11957R-BF405 100 µL

SLITRK4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
XBP1 Peptide - middle region
MBS3248517-01 0.1 mg

XBP1 Peptide - middle region

Sign In for Pricing
View Details
XBP1 Peptide - middle region
MBS3248517-02 5x 0.1 mg

XBP1 Peptide - middle region

Sign In for Pricing
View Details
Cytochrome C Oxidase Subunit 4 Isoform 2 (COX4I2) Antibody
abx332280 100 µL

Cytochrome C Oxidase Subunit 4 Isoform 2 (COX4I2) Antibody

Sign In for Pricing
View Details
IGF1 Peptide
42-659P 0.1 mg

IGF1 Peptide

Sign In for Pricing
View Details