Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-6, Equine

IL-6 protein is a crucial cytokine in immunity, tissue regeneration and metabolism. It binds to IL6R and forms a complex that binds to IL6ST/gp130, triggering intracellular IL6 signaling. Membrane-bound IL6:IL6R complexes induce "cluster signaling" that activates IL6ST receptors on neighboring cells. IL-6 Protein, Equine is the recombinant equine-derived IL-6 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-6 Protein, Equine, Equine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-6-protein-equine.html

Purity

98.0

Smiles

FPTPLPLGEDETTSNGPLLTTADKTKQHIKYILGKISALKNEMCNNFSKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMKITTGLSEFQIYLEYLQNEFKGEKENIKTMQISTKVLVQILMQKMKNPEVTTPDPTAKSSLLAKLHSQNEWLKNTTTHLILRSLEDFLQFSLRAVRIM

Molecular Formula

100034196 (Gene_ID) Q95181 (F26-M208) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AccuToolTM pRGEN-Cas9-CMV/T7 (nickase (D10A) Hygro-EGFP
ATS-0076 5 µg

AccuToolTM pRGEN-Cas9-CMV/T7 (nickase (D10A) Hygro-EGFP

Sign In for Pricing
View Details
Rabbit Polyclonal APBA2 Antibody
NBP2-41127 0.1 mg

Rabbit Polyclonal APBA2 Antibody

Sign In for Pricing
View Details
CUEDC2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
17134064 1.0 µg DNA

CUEDC2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A L-ribulose-5-phosphate 4-epimerase UlaF (ulaF)
MBS1226281-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi A L-ribulose-5-phosphate 4-epimerase UlaF (ulaF)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A L-ribulose-5-phosphate 4-epimerase UlaF (ulaF)
MBS1226281-02 0.1 mg (E-Coli)

Recombinant Salmonella paratyphi A L-ribulose-5-phosphate 4-epimerase UlaF (ulaF)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A L-ribulose-5-phosphate 4-epimerase UlaF (ulaF)
MBS1226281-03 0.02 mg (Yeast)

Recombinant Salmonella paratyphi A L-ribulose-5-phosphate 4-epimerase UlaF (ulaF)

Sign In for Pricing
View Details