Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Envelope glycoprotein B (gB), partial

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human cytomegalovirus gB protein, partial

Gene Name

GB

UniProt

P06473

Expression Region

552-635aa

Organism

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Target Sequence

TINQTSVKVLRDMNVKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAGNSAYEYVDYLFKRM

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Envelope glycoprotein that plays a role in host cell entry, cell to-cell virus transmission, and fusion of infected cells. May be involved in the initial attachment via binding to heparan sulfate together with the gM/gN complex that binds heparin with higher affinity. Interacts with host integrin ITGB1, PDGFRA and EGFR that likely serve as postattachment entry receptors. Participates also in the fusion of viral and cellular membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.1 kDa

References & Citations

"Disulfide bond configuration of human cytomegalovirus glycoprotein B." Lopper M., Compton T. J. Virol. 76:6073-6082 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-VPS4A-sgRNA3-Cas9-EGFP-Puro Plasmid
PVT85422 2 µg

PLV3-U6-VPS4A-sgRNA3-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Recombinant Human Protein SSX4 (SSX4)
MBS9020213-01 0.02 mg (E-Coli)

Recombinant Human Protein SSX4 (SSX4)

Sign In for Pricing
View Details
Recombinant Human Protein SSX4 (SSX4)
MBS9020213-02 0.1 mg (E-Coli)

Recombinant Human Protein SSX4 (SSX4)

Sign In for Pricing
View Details
Recombinant Human Protein SSX4 (SSX4)
MBS9020213-03 1 mg (E-Coli)

Recombinant Human Protein SSX4 (SSX4)

Sign In for Pricing
View Details
Recombinant Human Protein SSX4 (SSX4)
MBS9020213-04 5x 1 mg (E-Coli)

Recombinant Human Protein SSX4 (SSX4)

Sign In for Pricing
View Details
RPS15AP37 ORF Vector (Human) (pORF)
ORF031274 1.0 µg DNA

RPS15AP37 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details