Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-TBP

Product Specifications

CAS Number

9007-83-4

Gene Name

TATA box binding protein

Gene Aliases

HDL4, GTF2D, SCA17, TFIID, GTF2D1

Gene ID

6908

Accession Number

NP_003185

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TBP

Target

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease.

Partner Proteins

DR1; SSX2IP; GOLGA2; MEF2A; TAF8; GNG12; GNB2; UBC; UBE2I; TAF10; TAF5; HNF4A; E2F1; PAX5; TAF1A; TCEA1; RUVBL2; Abt1; GTF2A2; ICE2; tat; MED26; TBP; TAF6; TAF4; TAF1; SP1; TP53; SNAPC2; SNAPC1; MUC1; Taf1c; Taf1b; GTF2B; HCVgp1; AHR; TAF9B; BTAF1; TAF13

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCD

Applications

WB

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1.0 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

38kDa

Protein Length

339

NCBI Gene Symbol

TBP

Host or Source

Rabbit

Protein Name

TATA-box-binding protein

Gene Name URL

TBP

Nucleotide Accession Number

NM_003194

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GNB3 Antibody
NB100-98705-0.025mL 0.025 mL

Rabbit Polyclonal GNB3 Antibody

Sign In for Pricing
View Details
µLBP2 Human shRNA Plasmid Kit (Locus ID 80328)
TG300655 1 Kit

µLBP2 Human shRNA Plasmid Kit (Locus ID 80328)

Sign In for Pricing
View Details
Recombinant Candida Albicans ADE12 Protein (aa 1-428) (strain WO-1)
VAng-Lsx05261-50gEcoli 50 µg (E. coli)

Recombinant Candida Albicans ADE12 Protein (aa 1-428) (strain WO-1)

Sign In for Pricing
View Details
ELISA Flex: Human IgG high sensitivity (HRP)
3850-1H-6 For 6 Plates

ELISA Flex: Human IgG high sensitivity (HRP)

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD147
E10-31937 100 µL

Mouse Monoclonal Antibody to CD147

Sign In for Pricing
View Details
IRAK-1 (phospho Thr209) Polyclonal Antibody
MBS8520145-01 0.1 mg

IRAK-1 (phospho Thr209) Polyclonal Antibody

Sign In for Pricing
View Details