Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTX1 antibody - N-terminal region (P100957_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Orthodenticle homeobox 1

Gene Aliases

FLJ38361, MGC15736

Gene ID

5013

Accession Number

NP_055377

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OTX1

Target

OTX1 is a member of the bicoid sub-family of homeodomain-containing transcription factors. OTX1 acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy. This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.

Partner Proteins

KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-11; KRTAP10-1; KRTAP10-9; KRTAP12-2; LCE2D; LCE2A; LCE1B; LCE4A; MGAT5B; KRTAP3-3; KRTAP4-2; KRTAP4-7; KRTAP9-4; KRTAP9-2; KRTAP4-11; GEMIN8P4; KRTAP5-6; KRTAP26-1; KRTAP12-4; KRTAP3-2; KCNK16; KRTAP4-12; RGS17; RB

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSES

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 78%; Rat: 85%; Zebrafish: 85%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

37kDa

Protein Length

354

NCBI Gene Symbol

OTX1

Host or Source

Rabbit

Protein Name

Homeobox protein OTX1

Gene Name URL

OTX1

Nucleotide Accession Number

NM_014562

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ube2dnl2 Mouse shRNA Plasmid (Locus ID 75097)
TR518193 1 Kit

Ube2dnl2 Mouse shRNA Plasmid (Locus ID 75097)

Sign In for Pricing
View Details
DMRT3 (NM_021240) Human Tagged ORF Clone Lentiviral Particle
RC216289L4V 200 µL

DMRT3 (NM_021240) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NCI-H838 Cell Complete Medium
CM-0406 4x 125 mL

NCI-H838 Cell Complete Medium

Sign In for Pricing
View Details
Sodium Nitrite 1M (2N) Standardized Solution Nist traceable
892725 1 L

Sodium Nitrite 1M (2N) Standardized Solution Nist traceable

Sign In for Pricing
View Details
RPL7P19 3'UTR Lenti-reporter-Luc Vector
41877081 1.0 µg

RPL7P19 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RASGRP4 Protein Lysate (Human) with C-Ha Tag
38543031 100 µg

RASGRP4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details