Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRT1 antibody - N-terminal region (P100722_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Doublesex and mab-3 related transcription factor 1

Gene Aliases

DMT1, CT154

Gene ID

1761

Accession Number

NP_068770

Reactivity

Human, Cow, Dog, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DMRT1

Target

The gene encodes the DMRT1 protein is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain) . The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. This suggested that DMRT1 may be required for testis development.This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain) . The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

Dlg4; TRIM29

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSS

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 78%; Dog: 85%; Human: 100%; Pig: 78%; Rabbit: 92%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

39kDa

Protein Length

373

NCBI Gene Symbol

DMRT1

Host or Source

Rabbit

Protein Name

Doublesex- and mab-3-related transcription factor 1

Gene Name URL

DMRT1

Nucleotide Accession Number

NM_021951

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Apolipoprotein L2 Antibody [Biotin]
NBP2-98660B 0.1 mL

Rabbit Polyclonal Apolipoprotein L2 Antibody [Biotin]

Sign In for Pricing
View Details
Recombinant Escherichia coli UDP-galactopyranose mutase (glf)
MBS1151374-01 0.02 mg (E-Coli)

Recombinant Escherichia coli UDP-galactopyranose mutase (glf)

Sign In for Pricing
View Details
Recombinant Escherichia coli UDP-galactopyranose mutase (glf)
MBS1151374-02 0.02 mg (Yeast)

Recombinant Escherichia coli UDP-galactopyranose mutase (glf)

Sign In for Pricing
View Details
Recombinant Escherichia coli UDP-galactopyranose mutase (glf)
MBS1151374-03 0.1 mg (E-Coli)

Recombinant Escherichia coli UDP-galactopyranose mutase (glf)

Sign In for Pricing
View Details
Recombinant Escherichia coli UDP-galactopyranose mutase (glf)
MBS1151374-04 0.1 mg (Yeast)

Recombinant Escherichia coli UDP-galactopyranose mutase (glf)

Sign In for Pricing
View Details
Recombinant Escherichia coli UDP-galactopyranose mutase (glf)
MBS1151374-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli UDP-galactopyranose mutase (glf)

Sign In for Pricing
View Details