What is the catalog number for IL17F Protein?

The catalog number for IL17F Protein is OPPA01982-5UG.

What sizes are available for IL17F Protein?

IL17F Protein is available in the following size(s): 5 µg.

Is IL17F Protein in stock?

IL17F Protein is currently made to order / not held in immediate stock. Contact us for lead time.

IL17F Protein

Product Specifications

Gene Aliases

C87042, IL-17F

Gene ID

257630

Accession Number

NP_665855.2

Reactivity

Mouse

Target

Recombinant Mouse Interleukin-17F

Type

Protein

Sequence

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution

Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution IL17F should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.