Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin Protein

Product Specifications

Gene Aliases

Noggin, SYM1, SYNS1, NOG, Noggin Mouse, Noggin Mouse Recombinant

Gene ID

18121

Accession Number

NP_032737.1

Reactivity

Mouse

Target

Recombinant Mouse Noggin

Type

Protein

Sequence

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Lyophilized from a 0.2um filtered solution in 30% CH3CN, 0.1% TFA. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Mouse Noggin should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.

Notes

Formerly GWB-D79097

Protein Length

Recombinant

NCBI Gene Symbol

MNOGGIN

Host or Source

E. Coli

Protein Name

Noggin

Gene Name URL

MNoggin

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCDNA3.1-Slc25a20 Plasmid
PVT23058 2 µg

pCDNA3.1-Slc25a20 Plasmid

Sign In for Pricing
View Details
DUSP22 Antibody - N-terminal region (ARP87814_P050)
ARP87814_P050 100 µL

DUSP22 Antibody - N-terminal region (ARP87814_P050)

Sign In for Pricing
View Details
BCAM/CD239 Recombinant Protein Antigen
NBP2-31994PEP 0.1 mL

BCAM/CD239 Recombinant Protein Antigen

Sign In for Pricing
View Details
SMIM12 siRNA (Mouse)
orb1839245-01 15 nmol

SMIM12 siRNA (Mouse)

Sign In for Pricing
View Details
SMIM12 siRNA (Mouse)
orb1839245-02 30 nmol

SMIM12 siRNA (Mouse)

Sign In for Pricing
View Details
CD163 Polyclonal Antibody APC Conjugated
orb1540277 100 µL

CD163 Polyclonal Antibody APC Conjugated

Sign In for Pricing
View Details