Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin Protein

Product Specifications

Gene Aliases

Noggin, SYM1, SYNS1, NOG, Noggin Mouse, Noggin Mouse Recombinant

Gene ID

18121

Accession Number

NP_032737.1

Reactivity

Mouse

Target

Recombinant Mouse Noggin

Type

Protein

Sequence

MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Lyophilized from a 0.2um filtered solution in 30% CH3CN, 0.1% TFA. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution

Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Mouse Noggin should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.

Notes

Formerly GWB-D79097

Protein Length

Recombinant

NCBI Gene Symbol

MNOGGIN

Host or Source

E. Coli

Protein Name

Noggin

Gene Name URL

MNoggin

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine ES-Ab ELISA Kit
EBE0181 96 Tests

Bovine ES-Ab ELISA Kit

Sign In for Pricing
View Details
Human Microtubule Associated Serine/Threonine Kinase 2 (MAST2) ELISA Kit
BSKH63827-01 48 Tests

Human Microtubule Associated Serine/Threonine Kinase 2 (MAST2) ELISA Kit

Sign In for Pricing
View Details
Human Microtubule Associated Serine/Threonine Kinase 2 (MAST2) ELISA Kit
BSKH63827-02 96 Tests

Human Microtubule Associated Serine/Threonine Kinase 2 (MAST2) ELISA Kit

Sign In for Pricing
View Details
Purified (E.Coli) Recombinant Human BMP6 protein, Biologically active
BMP65-R-10 10 µg

Purified (E.Coli) Recombinant Human BMP6 protein, Biologically active

Sign In for Pricing
View Details
PRDM14 Lentiviral Activation Particles (m)
sc-436411-LAC 200 µL

PRDM14 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Aspochalasin T
orb1990750-01 1 mg

Aspochalasin T

Sign In for Pricing
View Details