Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eotaxin 2 Protein

Product Specifications

Gene Aliases

Ckb-6, MPIF2, MPIF-2, SCYA24

Gene ID

6369

Accession Number

NP_002982.2

Reactivity

Human

Target

Recombinant Human Eotaxin-2 (CCL24)

Type

Protein

Sequence

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution

Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CCL24 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.

Notes

Formerly GWB-43BC9B

Protein Length

Recombinant

NCBI Gene Symbol

EOTAXIN 2

Host or Source

E. Coli

Protein Name

C-C motif chemokine 24

Gene Name URL

Eotaxin 2

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHIT1 Recombinant Protein
OPCD02208-10UG 10 µg

CHIT1 Recombinant Protein

Sign In for Pricing
View Details
Plant Natural resistance associated-macrophage protein (NRAMP) ELISA Kit
OM641652 96 Tests

Plant Natural resistance associated-macrophage protein (NRAMP) ELISA Kit

Sign In for Pricing
View Details
C11orf82 (DDIAS) (NM_145018) Human Tagged Lenti ORF Clone
RC206347L4 10 µg

C11orf82 (DDIAS) (NM_145018) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
QuicKey Pro Human FE (Ferritin) ELISA Kit
E-OSEL-H0003-01 24 Tests

QuicKey Pro Human FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human FE (Ferritin) ELISA Kit
E-OSEL-H0003-02 48 Tests

QuicKey Pro Human FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human FE (Ferritin) ELISA Kit
E-OSEL-H0003-03 96 Tests

QuicKey Pro Human FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details