What is the catalog number for SPARC Protein?

The catalog number for SPARC Protein is OPPA01572-10UG.

What sizes are available for SPARC Protein?

SPARC Protein is available in the following size(s): 10 µg.

Is SPARC Protein in stock?

SPARC Protein is currently made to order / not held in immediate stock. Contact us for lead time.

SPARC Protein

Product Specifications

Gene Aliases

ON, ONT, OI17, BM-40

Gene ID

6678

Accession Number

NP_003109.1

Reactivity

Human

Target

Recombinant Human Secreted Protein Acidic & Rich in Cysteine

Type

Protein

Sequence

MSYYHHHHHHPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

The SPARC (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Reconstitution

Lyophilized Osteonectin although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution BM-40 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.