Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNV Envelope Protein

Product Specifications

Gene Aliases

WNV Envelope, West Nile Virus Envelope Recombinant

Reactivity

West Nile Virus

Target

West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.

Type

Protein

Source

E.coli

Sequence

MQLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKSGSSIGKAFTTTLKGALE.

Applications

ELISA, WB

Purification

Purified by proprietary chromatographic technique.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid.// 20mM Phosphate buffer pH 7.5.

Reconstitution

Stability: //Five years frozen. One month in solution at room temperature.

Notes

Formerly GWB-57821D

Specificity

Immunoreactive with sera of West Nile virus infected individuals.

Protein Length

Recombinant

NCBI Gene Symbol

WNV ENVELOPE

Gene Name URL

WNV Envelope

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS8 Adenovirus (Rat)
39487056 1.0 mL

RGS8 Adenovirus (Rat)

Sign In for Pricing
View Details
IRGQ Rabbit Polyclonal Antibody (Fluoro594)
orb3092339 100 µg

IRGQ Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Human Promyelocytic Leukemia Protein (PML) ELISA Kit
201-12-4633 96 Tests

Human Promyelocytic Leukemia Protein (PML) ELISA Kit

Sign In for Pricing
View Details
RIPK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61370R-BF405-01 20 µL

RIPK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
RIPK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61370R-BF405-02 100 µL

RIPK1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
N-{4- (tert-butyl) -2-[ (2,2,2-trichloroacetyl) amino]phenyl}-2,2,2-trichloroacetamide
OR27188 1 Each

N-{4- (tert-butyl) -2-[ (2,2,2-trichloroacetyl) amino]phenyl}-2,2,2-trichloroacetamide

Sign In for Pricing
View Details